KEGG   Mus musculus (house mouse): 72175
Entry
72175             CDS       T01002                                 
Symbol
Mfsd8, 2810423E13Rik, Cln7
Name
(RefSeq) major facilitator superfamily domain containing 8
  KO
K12307  MFS transporter, ceroid-lipofuscinosis neuronal protein 7
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    72175 (Mfsd8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    72175 (Mfsd8)
Transporters [BR:mmu02000]
 Major facilitator superfamily (MFS)
  Unknown transporters
   Others
    72175 (Mfsd8)
SSDB
Motif
Pfam: MFS_1 Sugar_tr
Other DBs
NCBI-GeneID: 72175
NCBI-ProteinID: NP_082416
MGI: 1919425
Ensembl: ENSMUSG00000025759
UniProt: Q8BH31
Position
3:complement(40772500..40801322)
AA seq 519 aa
MANLGSEAEREPLLGPGSPGSREWSEIETQEHYKSRWKSVRILYLTMFLSSVGFSIVIMS
IWPYLQKIDQTADASFLGWVIASYSLGQMVASPLFGLWSNYRPRKEPLIVSISISVAANC
LYAYVHVPAAHNKYYMLIARGLVGFGAGNVAVVRSYIAGATSLQERTNAMANTSTCQALG
FILGPVFQTCFALIGEKGVTWDIIKLQVNMYTAPVLLAAFLGILNIILILFILREHRVDD
LGRQCKSVNFQEENTDEPQIPEGSIDQVAVVATNIVFFVVLFIFAVYETILTPLTLDMYA
WTQEQAVLYDGILLVAFGVEAVLVFMGVKLLSKKIGERAILLGGFVVVWVGFFILLPWGN
QFPKIQWEDLHNSSTPNTTFGEIIIGLWNSSREDHSEQPTGCPIEQTWCLYTPVIHLAQF
LTAAVLIGTGYPACSVMSYTLYSKVLGPKPQGIYMGWLTTSGSAARILGPVFISHVYTYL
GPRWAFSLVCGIVVLTILLIGAVYKRLVAFSVRYMRIQE
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggcgaacctgggaagtgaggccgagcgggagcccctcttgggcccgggatcacccgga
agcagagaatggagcgagatagaaacccaagagcattacaagagtagatggaagtctgtg
aggattctctaccttaccatgttcctcagcagtgtgggtttttctattgtgataatgtcc
atctggccatatcttcaaaagattgatcagacagctgatgcaagttttttgggctgggtt
attgcttcatatagtcttggccaaatggtagcttcacctctatttggcttatggtctaat
tataggccgagaaaagaacctcttatcgtctccatctctatttcggtggcagccaactgc
ctatatgcgtatgtccacgtgccagctgctcataataaatactacatgttgattgctcgt
ggattggtgggatttggagcaggaaatgttgccgttgtccgatcatacattgctggtgct
acttcccttcaggaaagaacaaatgccatggctaatacaagcacatgccaagccctgggc
tttattctcggtccagtttttcagacttgctttgcactcattggagaaaaaggtgtgacg
tgggacatcatcaagctgcaggtcaacatgtacacagcaccagttttacttgcagccttc
ctgggaattctaaacattattctgattctttttatattaagagagcatcgtgtggatgac
ttgggacgtcagtgtaagagtgtgaattttcaagaagaaaatacagatgaacctcagatt
cctgaaggaagtattgatcaagttgctgttgtggctaccaatattgtgttttttgtggtt
ttatttatctttgctgtttatgaaacaatcctcaccccactaacactggatatgtacgcc
tggacccaggagcaggctgtgctctatgatggaatcctccttgttgcttttggagttgag
gcagttcttgtcttcatgggggttaaattactttccaaaaagattggcgagcgtgctatt
ctcctgggaggatttgtggttgtatgggtcggcttctttatcttgttaccctggggaaat
cagtttcccaaaatacagtgggaagatttacacaacagctcaacccctaatactacattt
ggggaaataattattggtctttggaattcttcaagagaagatcacagtgaacagccaact
gggtgcccaattgaacagacctggtgcctgtacaccccagtgattcatctggcccagttc
ctgacagctgctgtgttaattggaacaggctatccagcctgcagtgtcatgtcctataca
ttatactcaaaagttctaggacccaaacctcagggtatatacatgggctggttaaccact
tctggaagtgcagcacggattcttgggcctgtgttcatcagccatgtgtacacttacttg
ggcccacgatgggcattcagccttgtgtgtggaatagtagtgctcaccatcttgctaata
ggagctgtttacaaaagactcgttgccttttctgtcagatatatgaggatccaggagtaa

DBGET integrated database retrieval system