KEGG   Mus musculus (mouse): 72179Help
Entry
72179             CDS       T01002                                 

Gene name
Fbxl2, 2810423A21Rik, Fbl3
Definition
(RefSeq) F-box and leucine-rich repeat protein 2
  KO
K10268  F-box and leucine-rich repeat protein 2/20
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    72179 (Fbxl2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     72179 (Fbxl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_6 LRR_4 F-box-like LRR_1 F-box F-box_4
Motif
Other DBs
NCBI-GeneID: 72179
NCBI-ProteinID: NP_848739
MGI: 1919429
Ensembl: ENSMUSG00000032507
Vega: OTTMUSG00000031906
UniProt: Q8BH16 Q4VA21
Position
9; 9 F3
AA seq 423 aa AA seqDB search
MVFSNSDDGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRVDLFNF
QTDVEGRVVENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDS
TCYSLSRFCSKLKHLDLTSCVSVTNSSLKGISEGCRNLEYLNLSWCDQITKEGIEALVRG
CRGLKALLLRGCTQLEDEALKHIQNHCHELVSLNLQSCSRITDDGVVQICRGCHRLQALC
LSGCSNLTDASLTALGLNCPRLQVLEAARCSHLTDAGFTLLARNCHELEKMDLEECVLIT
DSTLVQLSIHCPKLQALSLSHCELITDEGILHLSSSTCGHERLRVLELDNCLLVTDASLE
HLENCRGLERLELYDCQQVTRAGIKRMRAQLPHVKVHAYFAPVTPPPAVAGSGHRLCRCC
VIL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggttttctcaaacagtgatgatggccttatcaacaagaagctacccaaggagctcctc
ttgagaatattctccttcttggacatcgtaactctatgccgatgtgcacagatctccaag
gcctggaacatcttagccctggatggcagcaactggcaacgggtggatctttttaacttc
cagacagatgtagagggccgagtggtggaaaacatctccaagaggtgcggtggcttcctt
agaaagctcagcctgcgtggctgcatcggagtcggggactcctctttgaagacctttgca
cagaactgccggaacattgaacatttaaacctcaatggctgcacgaaaatcactgacagc
acgtgttacagccttagcagattctgttccaagctgaaacacctggatctcacgtcctgc
gtgtctgttaccaacagctctttaaagggcatcagcgagggctgccggaacctggaatat
ctgaacctctcctggtgtgaccagatcacaaaggaaggcattgaggcgctggtgcggggg
tgccggggtttgaaagccctgctcctgaggggttgtacacagttagaggacgaagctctg
aaacacattcagaaccactgccacgagctggtgagcctcaacctgcagtcctgctcacgc
atcactgatgatggcgtggtgcagatctgcaggggctgccaccggctacaggctctgtgc
ctctcgggttgtagcaaccttacggatgcatctctcacagccttgggcctgaactgcccc
agactacaagttttggaggctgcccggtgctcccatctgaccgacgcaggctttacactg
ctagctcggaattgccatgagctggagaagatggaccttgaagaatgtgtcctgattacc
gacagcaccctcgtccagctctccatccactgtcccaagctgcaagccctgagcttgtcc
cactgtgagctcatcacagatgaggggatcctgcacctgagcagcagcacctgtgggcac
gagagactccgggtgctggagctggacaactgccttcttgtcacggacgcctcgctggag
cacctggagaactgccgaggcctggagcgactggagctttacgactgccagcaggtcacc
cgtgcaggcatcaagcgcatgcgggctcagcttcctcatgtcaaagtccatgcctacttt
gctccagtcacccctccaccagcagtggcaggaagtggacatcgactgtgcagatgctgt
gtcatactctga

DBGET integrated database retrieval system