KEGG   Mus musculus (house mouse): 72190
Entry
72190             CDS       T01002                                 
Symbol
2510009E07Rik, AI194952
Name
(RefSeq) RIKEN cDNA 2510009E07 gene
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: UPF0524
Other DBs
NCBI-GeneID: 72190
NCBI-ProteinID: NP_001001881
MGI: 1919440
Ensembl: ENSMUSG00000043391
UniProt: Q6GQU0
Position
16:complement(21467795..21513415)
AA seq 248 aa
MSAATAPERGWKSEKVDEAQALARSCAARRPDFQPCDGLSICATHSHGKCFKLHWCCHLG
WCHCKYVYQPMTPVEQLPSTEIPAKPREPTNTIQISVSLTEHFLKFASVFQPPLPPDSPR
YCMISDLFIDNYQVKCINGKMCYVQKQQAPHSQKMSPEEVSAHDALISKESDTPKLGHCS
SPSGSEDSGINAIGAHYVESCDEDTEEGAELSSEEDYSPESSWEPDECTLLSPSQSDLEV
IETMETTV
NT seq 747 nt   +upstreamnt  +downstreamnt
atgagtgcggccacggcgcccgagcgcggctggaagagcgagaaagtggacgaggcgcag
gccctggcgcggagctgcgccgcccgcagacccgacttccagccgtgcgacgggctgtcc
atctgtgccacgcacagccacggcaagtgcttcaagctgcactggtgctgtcacctggga
tggtgtcactgcaaatatgtgtatcagcctatgacccccgtggagcagctcccaagcaca
gagatccctgcaaagccccgagagccgactaacaccattcaaatctccgtctcgctcact
gaacactttttgaaatttgcgtctgtcttccagcctccgcttccccctgactcgccaagg
tactgtatgatttccgatctcttcatcgacaactatcaggttaaatgtattaatgggaag
atgtgctatgtgcagaagcagcaggcgccccactcccagaagatgagccctgaggaggtc
tctgcacacgatgccttaatttctaaagagagtgacactccgaaactgggtcactgctcc
tccccttccggttccgaggactcggggatcaacgccattggggctcactatgtggaatcc
tgtgatgaggacacagaagaaggggcggagctgagttccgaagaagattacagccctgag
agcagctgggaacccgatgagtgcaccctgctctccccatcgcagtcggatctggaagtg
attgaaacgatggagaccactgtgtag

DBGET integrated database retrieval system