KEGG   Mus musculus (house mouse): 72201
Entry
72201             CDS       T01002                                 
Symbol
Otud6b, 2600013N14Rik, AU015433
Name
(RefSeq) OTU domain containing 6B
  KO
K18342  OTU domain-containing protein 6 [EC:3.4.19.12]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    72201 (Otud6b)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     72201 (Otud6b)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    72201 (Otud6b)
SSDB
Motif
Pfam: OTU Peptidase_C65 FAM184
Other DBs
NCBI-GeneID: 72201
NCBI-ProteinID: NP_690025
MGI: 1919451
Ensembl: ENSMUSG00000040550
UniProt: Q8K2H2 A0A0A0MQF5
Position
4:complement(14809505..14826552)
AA seq 294 aa
MEEVVAEELDDEEQLVRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEREME
QKHREELEQLKQLTFKDSKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERI
AEAEIENLSGARHLESEKLAQILAARELEIKQIPSDGHCMYGALEDQLREQDCALTVASL
RRQTAEYMQTHSDDFLPFLTNPSTGDMYTPEEFGKYCDDIVNTAAWGGQLELRALSHILQ
TPIEILQADAPPIIVGEEYPRNPLVLVYMRHAYGLGEHYNSVTRLVNSATENCS
NT seq 885 nt   +upstreamnt  +downstreamnt
atggaggaggtcgtggctgaagagctcgatgatgaggagcagctggtgagaaggcatcgg
aaggagaagaaggagctgcaagccaaaattcagggaatgaagaacgctgttcccaaaaac
gacaaaaagaggaggaagcagctcacggaagatgttgctaaattggaaagagaaatggag
caaaaacacagggaagaactggagcaattgaagcaattgactttcaaggacagtaagata
gattctgttgctgttaacatttcaaacttggtacttgagaatcaaccacctcggatttca
aaagcacaaaagagacgggaaaagaaggctgcattggaaaaggagcgggaagaaaggata
gcagaggctgaaattgagaacttatctggagccagacatcttgagagtgaaaaacttgct
caaatattggcagccagagaattggaaattaaacagattccatctgatggtcactgtatg
tatggagcacttgaggatcagctgagagaacaagactgtgcgctgactgtggcttccctg
aggaggcagactgctgagtacatgcaaacccattcagacgacttcctgccgtttctaaca
aaccccagcacaggagatatgtacacgccagaagagtttgggaagtactgtgacgatatt
gtgaacacagcggcatggggcggtcagctcgagctaagagctttgtctcacatcttacaa
acaccaatcgagatactacaggcagatgctcctcctattatagtcggtgaagagtatccg
aggaatccattagtactagtatacatgaggcacgcgtatggcttaggagaacattataat
tctgttacacggttggtgaactcagctactgaaaattgcagctag

DBGET integrated database retrieval system