KEGG   Mus musculus (house mouse): 72236
Entry
72236             CDS       T01002                                 
Symbol
Tsnaxip1, 1700016K08Rik, TXI1
Name
(RefSeq) translin-associated factor X (Tsnax) interacting protein 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: TSNAXIP1_N DUF4407
Other DBs
NCBI-GeneID: 72236
NCBI-ProteinID: NP_077765
MGI: 1919486
Ensembl: ENSMUSG00000031893
UniProt: Q99P25
Position
8:106554343..106571310
AA seq 704 aa
MANLQERKSFSKPRISIQASGGTPEAKGIEKRKLSQKRRTLPLQLSLGGHLSPWPTYTSG
QTVLHNRKPCSDDSRNRANSCQQQSMSISKPKYLEQLENYLRKELLLLDLSTDSAQELRL
QPYREIFEFFIEDFKTYKPLLSSIKNAYEVMLAHQKERIRSLEPLKAKIVTMNEDCSERV
LAMRAEERYEISVLKKEKMNLLKLIDKKNEEKISLQSEVAKLRRSLAEEYLRYLTERDAR
KILIGDLNELRYQQEDMSLAQTPGVWGEDPVKLTLALKMTRQDLTRTQMELNTMKANSGD
VVPRRDLEMQEKTNMELQEQLESLKADYEEVQKEHELLLQLHMSTLKERDQFYNELQEIQ
RTSTPRPDWTKCESIIAGGPERWLVLAEGKNSDQLVDVLLEEIGMGLLREKDFFPGLGFG
DAIPPFLRFDGPVKNKKPSKKEVVNLLKDAWKERIAEEQKEPFPDFFFNFLERRFGVNDA
MAWAYTIFENIKLFRSSEIMNQFYAVLMGKNLESVYINQKKTLSHLLKELLSVDTQNEGS
ITMEQFSTILKTTFPLKKEEQIQELMEAVGWGPDSSNTDMLNYRSLFNEDEEGQSEPFVQ
RLWEQYESDKEAYLEELKQELDLDPLEDVTLLKMRGTLMNIDPTMDKQTLSAYLSQAYQI
PAIDVPLEDEEKQGIISIKVETALDRLRMADTKRVGPREPDPAS
NT seq 2115 nt   +upstreamnt  +downstreamnt
atggccaacctacaggagcgtaaaagtttctccaagccaagaataagtatacaagcttca
ggagggactccggaagccaagggcattgagaaacgcaagctttctcagaaacgaaggaca
ctgcccttgcagttatccttgggtggccacctgtcaccatggcctacatacaccagtggc
cagacagttctacataatcgaaagccctgttcagatgacagccggaatcgagccaatagc
tgccagcagcagtccatgagcatctccaagcccaagtacctggagcaactagaaaactac
ctgcgcaaggaactcctcctgctggacctgagcacggattctgcacaggaactgaggctg
cagccttatagggagatctttgagttcttcatagaggatttcaagacatacaagccactg
ttatcctccatcaagaatgcgtacgaggtgatgctagcccaccaaaaggagagaatccgg
tccctggagcccctgaaggccaagattgtcaccatgaacgaggactgcagtgagagggtc
ctggccatgagggctgaggagaggtacgaaatctctgtgctcaagaaagagaagatgaat
ttgctaaaactcatcgacaaaaagaacgaagagaagatctcactgcagagcgaggtagct
aaactgaggaggagcctggctgaggagtatctgcgttatcttaccgaacgagatgcccgc
aaaattctgattggggacctgaatgaactgaggtaccagcaagaagacatgtcactagcc
cagaccccaggtgtttggggagaagacccagtgaagctaacattggcactgaagatgact
cgacaagacctgactcgcacacagatggaacttaacacaatgaaagccaactctggagat
gtggtacccaggagagacttggaaatgcaagagaagaccaacatggagcttcaagagcag
ctagaaagcctgaaagccgactatgaagaagtccaaaaggaacacgagctgctgctgcag
ttgcacatgagcacactaaaggagcgggaccagttctataatgagttgcaggagatccag
cgcacctccacaccgcgacctgactggaccaaatgcgaaagtatcatagcagggggccca
gagcgctggctagtgctggctgaaggaaagaacagtgatcagctggtggatgtgctcctg
gaggaaatcggcatgggtctgcttcgggagaaagacttcttccctggcctgggctttggg
gatgccatcccccccttccttcggtttgatggccctgtgaagaacaagaagccaagcaag
aaggaggtggtaaacctccttaaggatgcctggaaggaacgcattgcagaggaacagaag
gagccatttccagatttcttcttcaattttctggagcgtcgctttggggtcaatgatgcc
atggcctgggcttacaccatttttgaaaatatcaagctctttcgttccagtgagatcatg
aatcagttctatgcagtattgatgggaaagaatttggagagtgtatatatcaatcaaaaa
aagacactgtcccatctgctgaaggagttgctaagtgttgacactcagaatgagggatca
atcaccatggaacagttcagcaccatcctcaagaccacctttcctctcaagaaggaagag
cagattcaggagctgatggaggcagtaggctggggtccagacagcagcaacacagacatg
ttaaactaccgatctttgtttaatgaggatgaggaagggcagagtgagccatttgtgcag
aggctgtgggaacagtatgaaagtgacaaggaagcatacttagaggaactgaagcaggag
ctagacctggatcctcttgaagacgtgaccctactgaagatgcgtgggaccctgatgaac
atagatcctaccatggacaagcagactctgagtgcctacctgagccaggcctatcagatc
cctgcaattgatgtgccactggaggatgaggagaagcaggggataatctccataaaggtt
gagactgcacttgatcgacttaggatggcagacacgaagcgtgtaggaccacgagagcca
gacccagcaagctag

DBGET integrated database retrieval system