KEGG   Mus musculus (mouse): 72258Help
Entry
72258             CDS       T01002                                 

Gene name
Kcnk10, 1700024D23Rik, 3010005K24Rik, Trek2
Definition
(RefSeq) potassium channel, subfamily K, member 10
  KO
K04920  potassium channel subfamily K member 10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    72258 (Kcnk10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    72258 (Kcnk10)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    72258 (Kcnk10)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     72258 (Kcnk10)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   72258 (Kcnk10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans_2 Ion_trans DUF2390 PLC-beta_C PDZ_3 E1-E2_ATPase
Motif
Other DBs
NCBI-GeneID: 72258
NCBI-ProteinID: NP_001303593
MGI: 1919508
Ensembl: ENSMUSG00000033854
UniProt: F6YU65
Position
12; 12 E
AA seq 521 aa AA seqDB search
MAVPAAAPPVCQPKSATNGHHPVPRLSISSRATVVARMEGASQGGLQTVMKWKTVVAIFV
VVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHICVSPQELETLIQHALDADNA
GVSPVGNSSNSSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGF
LLAGIGDQLGTIFGKSIARVEKVFRKKQVSQTKIRVISTILFILAGCIVFVTIPAVIFKY
IEGWTALESIYFVVVTLTTVGFGDFVAGGNAGINYREWYKPLVWFWILVGLAYFAAVLSM
IGDWLRVLSKKTKEEVGEIKAHAAEWKANVTAEFRETRRRLSVEIHDKLQRAATIRSMER
RRLGLDQRAHSLDMLSPEKRSVFAALDTGRFKASSQESINNRPNNLRLKGPEQLTKHGQG
ASEDNIINKFGSTSKLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEKKEDETEKMCNSD
NSSTAMLTECIQQQAEMENGMVPTDTKDQGLENNSLLEDRN
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgcctgcagcagccccaccagtgtgccagcccaagagtgccactaacgggcat
caccctgttcctcgactctccatttcctctcgagccacggtggtagccaggatggaaggc
gcctcccagggaggcctgcaaacagttatgaagtggaaaacagtggttgccatcttcgtg
gtggtcgtggtctacctcgtcactggtggccttgtcttccgggccttggaacagcccttc
gagagcagtcagaagaacacaatcgccttggagaaggcagaattcttgagagatcacatc
tgtgtgagtccccaggaactagagacactgattcagcatgcactcgatgctgataacgcg
ggagtcagcccagtaggaaactcttccaacagcagcagtcactgggaccttggaagtgcc
ttcttctttgctgggacagtcatcacaaccatagggtatgggaatattgctccgagcact
gaaggaggcaaaatcttttgtattttatatgccatctttgggatcccgctttttggtttc
ttattggctggaattggagaccaacttggaaccatctttggcaaaagcattgcaagagtg
gaaaaggtttttcgaaagaagcaagtgagccagaccaagatccgggtcatctccacgatt
ctcttcatcttggctggctgcatcgtgtttgtgaccatccctgctgtcatctttaaatac
atcgagggttggaccgccttggagtccatctactttgtggtagtcacgctgaccacagta
ggctttggtgattttgtggcagggggaaatgctggcatcaattaccgagagtggtacaag
ccgctggtgtggttttggatccttgttggccttgcctactttgcagctgtcctcagtatg
atcggagactggctgcgggttttatccaaaaagacaaaagaagaggttggtgagatcaaa
gcccacgcagctgagtggaaggctaatgtcactgctgagttccgggagacgagaaggcgg
ctcagcgttgagatccatgacaagctgcaacgggcagccactatccgaagtatggagcgc
cggaggctgggcttggaccagagggcccactcactggacatgctatcccctgagaagcgt
tctgtctttgcagccctggacacaggccgtttcaaggcctcatcgcaggagagtatcaac
aacagacccaacaacctacgccttaaggggccagaacagcttaccaaacatgggcagggc
gcttctgaggacaacatcatcaacaagtttgggtccacctccaaactcacaaagaggaaa
aacaaagatctcaaaaagaccttacccgaggatgttcagaaaatctacaaaaccttccgg
aattactctctggatgaagagaagaaagaggacgagacagaaaagatgtgtaactccgac
aactccagcacagccatgctgacagagtgtatacagcagcaagctgagatggagaacgga
atggtacccacggacaccaaagaccaggggctggagaacaattctttacttgaagacaga
aactaa

DBGET integrated database retrieval system