KEGG   Mus musculus (mouse): 72273Help
Entry
72273             CDS       T01002                                 

Gene name
Smim24, 2210404O07Rik
Definition
(RefSeq) small integral membrane protein 24
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: MAP17 LYRIC Zip Oxidored_q3 DUF1772 MotB_plug SID-1_RNA_chan
Motif
Other DBs
NCBI-GeneID: 72273
NCBI-ProteinID: NP_001093387
MGI: 1919523
Ensembl: ENSMUSG00000078439
Vega: OTTMUSG00000030397
UniProt: Q0VG18
Position
10; 10 C1
AA seq 120 aa AA seqDB search
MDTLGRLLLLATLFLTPAEAQQASERRLKPWLVGLAAVVGFLFIVFILMLANRVWCAKGR
AEDEEATFRMEHIMNENSQPSKADKKQKKKVDRKGGQSNEALELEEKESSDEERGKKTAL
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggacaccttgggcaggctgctgctgctggctacactgttcctgacacccgctgaggcc
cagcaggcctcagagcgccgcctgaagccttggctagtaggcctggctgcagtagtgggc
ttcctgtttatagtcttcatcctcatgctggccaatcgtgtctggtgcgccaaaggcaga
gcagaggatgaggaggctacattcagaatggagcacattatgaacgagaactcacagcca
agtaaagcagacaagaagcagaagaagaaggtggacaggaagggcggacagagcaacgag
gccttggaactagaggaaaaggagtcctcagatgaggagagaggcaagaaaacagctttg
taa

DBGET integrated database retrieval system