KEGG   Mus musculus (house mouse): 72284
Entry
72284             CDS       T01002                                 
Symbol
LTO1, 2210010N10Rik, Oraov1, TAOS1
Name
(RefSeq) ABCE maturation factor
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Yae1_N FAD_binding_1
Other DBs
NCBI-GeneID: 72284
NCBI-ProteinID: NP_082460
MGI: 1919534
Ensembl: ENSMUSG00000031072
UniProt: Q8CH62 Q3TF33
Position
7:144468837..144484485
AA seq 151 aa
MKGMRGPGESRDTAMAVEQDIFDAVVMADERFHGEGYQEGYEEGSSLGIVEGKRYGMVHG
AKIGSEIGCYRGFALAWKCLLHSGAGEKDSRKMKVVEALIALLQDFPYDDPTYEKLHEDL
DRIRGKFRQLCSLLNVQPDFKVTPGGSGLAF
NT seq 456 nt   +upstreamnt  +downstreamnt
atgaaaggaatgcgagggccgggggagagccgagacaccgccatggccgtggagcaggac
atatttgacgccgtcgtgatggcggatgagagattccatggggagggatatcaggaaggc
tatgaagaaggcagtagcttggggatcgttgaaggaaagcggtatggcatggtacatgga
gccaagattgggtctgagattggatgctaccggggttttgctcttgcatggaagtgtctc
ctacacagtggcgctggtgaaaaagacagcaggaagatgaaggtggtggaggctctgatt
gcgctgctgcaggactttccttacgatgatcccacttatgagaagctccatgaagacctg
gacagaatcagagggaagttcaggcagctgtgctcactgctcaacgtgcagccagacttc
aaggtgactccaggaggctctggacttgcgttttga

DBGET integrated database retrieval system