KEGG   Mus musculus (house mouse): 72306
Entry
72306             CDS       T01002                                 
Symbol
Zfp777, 2500002G23Rik
Name
(RefSeq) zinc finger protein 777
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    72306 (Zfp777)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    72306 (Zfp777)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    72306 (Zfp777)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz DZR zf-C2H2_6 Zn-ribbon_8 zf-H2C2_5 CpXC zf-met DUF2321 C1_4
Other DBs
NCBI-GeneID: 72306
NCBI-ProteinID: NP_001074851
MGI: 1919556
Ensembl: ENSMUSG00000071477
UniProt: B9EKF4
Position
6:complement(47994594..48026963)
AA seq 885 aa
MAEAAPARGRAARARTDARPRGPGDSLRAPGSVARPGVSVQQLDMEDDRSSPLSFSSVPH
EESVRQAPARLPRETVFPSCILPPKEVPPLSPTASRQGVLPQTDSTTKQETSSQMSHVLQ
KGPSLLYPATSEQDTPHQVSLASQEETQCSPSAAAQGIPFLSHSAHRQEAPLHSPEVPEK
DSLTLSPTVPETDMDPLLQSPTLQKDTPFHTSSAAQKEQPLPTAEITRLAVWAAVQAVER
KLEAQAMRLLTLEGRTGTNEKKIADCERTAVEFANHLESKWVVLGTLLQEYGLLQRRLEN
MENLLKNRNFWILRLPPGSNGEVPKVPVTFDDVAVHFSEQEWGNLSEWQKELYKNVMRGN
YESLVSMDYAISKPDLMSQMERGERPAMQEQEDSEEGETPTDPSAAHDGIVIKIEVQTND
EGSEGLETPEPLMGQVEEHGFQDSELGDPCGEQPDLDMQEQENALEESTEGSSEFSELKQ
MLVQQRNCTEGIVIKTEEQEEEEEEEEEDELPQHLQSLGQLSGRYEASMYQTPLPGEMSP
EGEESPPPLQLGNPAVKRLAPSIHGHTHGHGHGHGHSERHLGENRGNSSQQQRNRRGERP
FTCMECGKSFRLKINLIIHQRNHIKEGPYECAECEISFRHKQQLTLHQRIHRVRSGYASP
ERGSAFNPKHSLKPRPKSPSSGSGGGPKPYKCPECDSSFSHKSSLTKHQITHTGERPYTC
PECKKSFRLHISLVIHQRVHAGKHEVSFICSLCGKSFSRPSHLLRHQRTHTGERPFKCPE
CEKSFSEKSKLTNHCRVHSRERPHACPECGKSFIRKHHLLEHRRIHTGERPYHCAECGKR
FTQKHHLLEHQRAHTGERPYPCTHCAKCFRYKQSLKYHLRTHTGE
NT seq 2658 nt   +upstreamnt  +downstreamnt
atggccgaggcggccccggctcgggggagggcagcccgcgcgcgcacggacgcgcggcct
cggggccccggggacagcctgcgtgctccgggctcggtggcccggcctggggtctcggtc
cagcagctggacatggaggacgatcgctcgtcaccactgtcattctccagtgtcccacac
gaagagtctgtgcgtcaggcccctgctcgactccctagagaaactgtgttcccttcttgc
attcttcctccaaaagaagttcctcctttgtctcccactgcctcccggcaaggtgtcttg
ccccagactgacagtactactaagcaagagacatccagccagatgtcacatgttcttcag
aaaggaccttcactcctgtatcctgccacttctgagcaagacacacctcaccaggtatcc
cttgcttcccaggaagaaacccagtgctctccttcagcagctgctcaggggatccccttc
ctctcgcactccgcccaccgtcaggaagctccactccactctcctgaggttcctgagaaa
gactcgctgactctctcacccacagttcccgagaccgacatggaccccttgctccagagt
cccactttgcaaaaggacactcccttccatacctcttctgccgcccagaaagaacagcca
ctgcccactgcagagatcactcgattggctgtgtgggctgctgtccaagcagtggagagg
aaactggaggcccaggccatgcgactactgactctggagggcaggacagggacaaatgag
aagaagatagcagactgtgagagaacggctgtggagttcgcaaatcatctggagagcaag
tgggttgtactggggaccttactgcaggagtatgggctgctgcagcggcgcctggagaac
atggagaatctgctgaaaaacagaaacttctggatcctgcggctgcccccaggcagcaat
ggagaagttcccaaggttcctgtcacattcgatgatgtcgccgtccatttctctgagcag
gaatggggaaatctctctgagtggcagaaggagctctacaagaatgtaatgaggggcaac
tatgagtctctggtctctatggactatgcaatatccaaaccggacctcatgtcacagatg
gagcgtggagagaggccagccatgcaagaacaagaggattctgaggagggtgagacgccc
acagatcccagtgctgcacatgatggcatcgtgattaagatcgaggtgcagaccaacgat
gagggctcagaaggtctggagacaccagagccactgatgggacaagtggaggaacatggc
tttcaggactcagagctgggtgacccctgtggagagcagccagacctggacatgcaggaa
caagagaacgcgctcgaggagtccacggaaggctccagcgagttcagtgagctcaagcag
atgctggtgcagcagagaaactgcacggaggggatcgtgatcaagacagaggagcaggag
gaggaggaggaagaggaagaggaggacgagctgccacagcacttgcaatcccttgggcag
ctgtctgggaggtacgaggccagtatgtaccagacccccctacctggggagatgtccccc
gagggcgaggaaagccccccacccctgcagttgggcaacccagcagtgaagaggctggca
cccagcattcatgggcatacgcatgggcatgggcacgggcacgggcacagtgaacggcac
ctgggtgagaaccgtgggaactctagccagcagcagcggaatcggcgtggtgagaggccc
ttcacttgcatggagtgtggcaaaagctttaggctgaagattaacctcatcatccaccag
cgtaaccacatcaaggaggggccctacgagtgtgccgagtgtgagatcagcttccgccac
aagcagcaactcacgctgcaccagcgcatccaccgggtacgcagcggctatgcctcccct
gagcgcgggtcagccttcaatcccaagcactcgctcaaaccacgtcccaaatcgcccagc
tcaggcagtggcggcggccccaaaccctacaaatgccctgagtgtgacagcagcttcagc
cacaagtcaagcttgaccaagcaccagatcacacacacgggtgagcggccctacacgtgc
ccagaatgcaagaagagcttccgcttgcatatcagtctggtgatccaccagcgtgtgcat
gcaggcaagcacgaagtctccttcatttgcagtctgtgcggcaagagtttcagccgcccg
tcgcatctgctgcgccaccagcggactcatactggtgaacggccttttaagtgcccggag
tgcgagaagagcttcagtgagaaatctaagctcaccaaccactgccgcgtgcactcccgc
gagcggccgcacgcctgccctgagtgcggcaagagcttcatccgcaagcaccacttgctg
gaacaccggcgcatccacacgggtgagcggccctaccactgcgccgagtgtggcaagcgc
ttcacgcagaagcaccacctgctggagcatcagcgtgcgcacacaggcgagcggccatac
ccctgcacgcactgcgccaagtgcttccgctacaaacagtcgctcaagtaccacctgcgg
acccacacgggcgagtga

DBGET integrated database retrieval system