KEGG   Mus musculus (house mouse): 72315
Entry
72315             CDS       T01002                                 
Symbol
Ccdc74a, 2310015A05Rik
Name
(RefSeq) coiled-coil domain containing 74A
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: CCDC74_C CCDC92 LCD1 CCDC106 ACCA
Other DBs
NCBI-GeneID: 72315
NCBI-ProteinID: NP_001159636
MGI: 1919565
Ensembl: ENSMUSG00000041617
UniProt: E9Q9U8
Position
16:17464334..17468602
AA seq 364 aa
MSGAGLAAGARPLSSAAPGSRGAARLRPRPPAGLQHAGTQPPPLGFSEAQKRILDLEKSL
QFLQQQHSETLVKLHEEIEHLKRENKDLHYKLIMNEKPQKKGSISTWSLHSGKSASNSTM
SANSQGKTRPQPSSFKKQELKSEALQKTDLEEQSLSSAALSHSSKLDRVPGAQGQAKDED
AEPSNSGATLVGGSHGRQGTGMAPLMSLPPHLRKPTTVQQCEVVIRQLWNANLLQAQELR
HLKSLLEGNQRPKAAAEEAGLGSPKDQDTMQFPKVTSKGLSKKCLILSPMPAAERGILPA
LKQSLKNNFAERQKRLQVVQSRRLHRSVLLSRRPGARPSSLDSGSHQPYFAATRNSKTDR
THDR
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgagcggggccgggctggcggccggggctcggcccctcagctccgcggccccaggctcc
cggggcgcggcccgcctacgcccgcgccctcccgccggcctgcagcacgcggggacgcag
ccgcctccgctcgggttcagcgaagcacagaagcggatcctggacctggaaaagagcctg
cagttcctacagcagcagcactcggagacgctagtcaaactccacgaggagatcgagcac
ctgaagcgggagaataaggatctccactacaagctaatcatgaatgagaagcctcagaaa
aaaggcagcatctccacatggagccttcactctggcaagtccgcctccaattccacgatg
tccgccaactctcaaggcaagaccaggccccagcccagctccttcaagaaacaagagctg
aagtctgaagccctccaaaagacagacctggaagagcagtcactcagcagtgctgccctg
tcccacagcagcaagctggacagagtccctggggctcagggacaggccaaagacgaggat
gcagagccctctaattcaggggccacgttggtggggggcagccatggccggcaagggacg
gggatggcccccttaatgagcctgcccccgcacctgcgcaagcccaccacagtgcagcag
tgtgaggtggtcatccgtcagctgtggaacgccaacctcctgcaggcccaggagctacgg
cacctcaagtcactcctggaagggaaccaaaggcccaaagctgcagctgaggaggctggg
ctgggttctccaaaggaccaggacaccatgcagtttcccaaggtcacctccaagggcctt
agtaagaagtgcttaattctgagcccaatgcctgctgcagagcgaggcatcctgcctgca
ttgaaacagagcctgaagaacaactttgctgagcggcagaaaaggctgcaagtagtacag
agccgccgcctgcaccgctctgtgctgctgagccggcgccctggagcccggccatcctct
ctcgatagtggctcacaccaaccctattttgcagccacacgcaattccaaaacagacaga
acccacgacagataa

DBGET integrated database retrieval system