KEGG   Mus musculus (house mouse): 72318
Entry
72318             CDS       T01002                                 
Symbol
Cyth4, 2510004M07Rik, 5830469K17Rik, AI467541, Pscd4, mFLJ00017
Name
(RefSeq) cytohesin 4
  KO
K18441  cytohesin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    72318 (Cyth4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    72318 (Cyth4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    72318 (Cyth4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    72318 (Cyth4)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    72318 (Cyth4)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    72318 (Cyth4)
SSDB
Motif
Pfam: Sec7 PH PH_11 Syntaxin-6_N PH_20 PH_3 PH_8 APG6_N XkdW
Other DBs
NCBI-GeneID: 72318
NCBI-ProteinID: NP_082471
MGI: 2441702
Ensembl: ENSMUSG00000018008
UniProt: Q80YW0 Q3U0C0 Q3U8A6 Q3U6Y6
Position
15:78481247..78506219
AA seq 393 aa
MDVCHTDPAELSSGEAKELQQIKWHRKQLLEDIQKLKDEIADVFAQIDCFESTEESRMAQ
KEKEMCIGRKKFNMDPNKGIQYLIEHKLLTSDVQDIAQFLYKGDGLNKTAIGTYLGEKDP
INLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAARYCLCNPGVFR
STDTCYVLSFSVIMLNTGLHNPNVRDRPPFERFVTMNRGINSGSDLPEEQLRNLFDSIKS
EPFSIPEDDGGDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEFTTDKEPR
GIIPLENLSVQKVEDPKKPFCLELYNPSCRGQKIKACKTDGDGKVVEGKHESYRISAANA
EERDQWIEAIRASITRVPFYDLLSARKKKIVGK
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggatgtgtgtcacacagatccagctgagctcagcagtggggaggccaaggagctacag
cagatcaaatggcacaggaagcagctactggaagacatccagaaactgaaggatgagatt
gcagatgtgtttgcccaaatcgactgctttgaaagcaccgaggagagccggatggcgcag
aaagagaaggagatgtgcatcgggagaaagaaattcaacatggaccctaataagggcatc
cagtatctcattgagcacaagctgctgacctctgatgtccaggacatcgcccagttcctg
tacaagggtgacggtctcaacaagacagccattggcacctacttgggggaaaaggacccc
atcaacttgcaggtcctgcaggcctttgtggactgccatgagtttgccaacctcaacctc
gttcaggccctcaggcagttcctgtggagcttcaggctgccgggtgaggcccagaagatt
gaccgcatgatggaggccttcgctgctcgctactgcctctgtaaccccggagtcttccgg
tccacagacacctgctacgtgctgtccttctccgtcatcatgctcaacaccggcctacac
aaccccaacgtgcgggacagaccacccttcgagcgctttgtgaccatgaatcgcggcatc
aacagcggcagtgacctgcccgaggagcagctacggaacctgtttgacagcatcaagagt
gagcccttctccatccctgaggatgatggcggtgacctcactcacaccttctttaacccc
gaccgtgaaggctggctactcaagctggggggccgtgtgaagacatggaagcggcgctgg
ttcattctcactgacaactgtctctactactttgagttcaccactgacaaagaacctcgg
gggatcattcccctggaaaacctctccgtgcagaaggtagaggaccccaagaagccgttc
tgcctggagctgtacaaccccagctgccggggccagaagataaaggcatgcaagacagac
ggggacggcaaggtggtagaaggcaaacatgaatcctaccgcatctcagctgccaatgcc
gaggaacgcgaccagtggatcgaggccatcagggccagcatcacccgagtccccttctac
gacctgttgtctgctcggaaaaagaagattgtcggcaagtag

DBGET integrated database retrieval system