KEGG   Mus musculus (mouse): 72320Help
Entry
72320             CDS       T01002                                 

Gene name
Kif1bp, 0710007C18Rik, 2510003E04Rik, KBP, mKIAA1279
Definition
(RefSeq) KIF1 binding protein
  KO
K23845  KIF-binding protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    72320 (Kif1bp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KBP_C TPR_1
Motif
Other DBs
NCBI-GeneID: 72320
NCBI-ProteinID: NP_082473
MGI: 1919570
Ensembl: ENSMUSG00000036955
Vega: OTTMUSG00000031220
UniProt: Q6ZPU9
Position
10; 10 B4
AA seq 617 aa AA seqDB search
MANAPGPEIREKFQAALALSRVELHKNPEKEPYKSKYGARALLEEVRALLGPAPEDEDEP
AADDGPGDQALGAGEPREAEGPGAQRALRLAVVEFHLGVNHIDTEELSAGEEHLVRCLSL
LRPYRLSLGCVSLYIQAQNNLGILWSEREEIETARTYLESSEALYSQYMKEIGSPPLDPT
EHFLPEEEKLTEQERSKRFEKVYTHNLYYLAQVYQHMEMFEKAAHYCHSTLKRQLEHNAY
HPMEWAINAATLSQFYINKLCFMEARHCLSAANVIFGQTGKIPATEDTPEVEGDVPELYH
QRKGEIARCWIKYCLTLMQNAQLSMQDNIGELDLDKQSELRALRKKELDEEESVRKRAVQ
FGTGELCDAISAVEEKVRYLRPLDFEEARELFLLGQHYVCEAKEFFQIDGYVTDHIEVVQ
DHSALFKVLSFFEADMERRCKMHKRRIAMLEPLTVDLNPQYYLLVSRQIQFEIAHAYYDM
MDLKVAIADKLRDPDSHIVKKINSLNKSALKYYQLFLDSLRDPNKVFPEHIGEDVLRPAM
LAKFRVARLYGKIITADPKKELENLATSLEHYKFIVDYCETHPEAAQEIEVELELSKEMV
SLLPTKMERFRAKMALT
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgctccggggccagagatccgcgagaagttccaggcagcgctggccctgtcg
cgggtggagctgcacaagaacccggagaaggagccgtacaagtccaagtacggcgcgcgc
gcgctgttggaggaggtgcgcgcgctgctgggcccggcgcccgaggacgaggacgagccg
gctgctgacgatgggccgggcgaccaggccttgggcgcgggtgagccccgggaggctgag
ggccccggagcgcagcgggcgctgcgcctcgcggtggtcgagttccaccttggtgtgaac
cacatcgacacggaggaactgtctgccggcgaggagcatctggtcaggtgcctgtcgttg
ctgcgcccctaccgcctgtcgctcggctgtgtgtctctctacatccaggcgcagaataac
ctgggcatcctgtggtctgaaagggaagagatcgaaaccgcccggacctacctggagtca
tcggaagccctgtacagtcagtacatgaaagagattgggagcccgcctcttgacccgact
gagcattttcttcctgaagaagagaaacttactgaacaagagagatcaaaaagatttgag
aaggtttatactcataacctgtattacctggctcaagtctaccagcacatggaaatgttc
gagaaggccgctcattattgccacagcacactgaaacgccagcttgaacacaatgcctac
caccccatggagtgggccatcaacgccgctactctatcacagttctacatcaataagctc
tgttttatggaagccagacattgtctgtcagctgctaatgttatttttggtcaaactgga
aaaataccagctacagaagacactcctgaagttgaaggagacgtgccagagctttaccat
cagaggaaaggggaaatagcaagatgctggatcaagtactgcctgactctgatgcaaaac
gcgcagctctccatgcaggacaacataggagagcttgacctggacaagcagtcggagctc
agagctctacgcaagaaggagctagatgaggaggagagcgtcaggaaaagggctgtgcag
tttggaactggggagctgtgcgacgccatctctgcagtggaggagaaagtgagatacttg
aggcccttagattttgaagaagccagggagcttttcctgctgggtcagcactatgtgtgt
gaggcaaaggagttcttccagatcgatgggtatgtcactgaccacattgaagttgtccag
gaccacagcgctctgttcaaggtgctctcgttctttgaggctgacatggagagacggtgc
aagatgcacaagcgcaggatagccatgctagagcccctgactgtggacctgaacccacag
tactacctgttggtcagcaggcagattcagtttgaaatcgcacacgcgtactatgacatg
atggacttgaaggtcgccattgctgacaagctcagggaccccgactcacacattgtcaaa
aaaataaatagcctgaataagtcggcactcaagtactaccagctcttcctagactccctg
agagacccaaacaaagtctttcctgagcacatcggggaagacgtcctccgcccggccatg
ttagctaaattccgggtagctcgtctgtatggcaaaatcatcactgcagatcccaagaaa
gagctagagaatttggcaacatctttggaacattacaaatttattgttgattactgtgaa
actcaccccgaggctgcccaggaaatagaggttgagttagaacttagtaaagagatggtc
agtctcctcccaacaaaaatggagaggttcagagccaagatggccctgacctaa

DBGET integrated database retrieval system