KEGG   Mus musculus (mouse): 72322
Entry
72322             CDS       T01002                                 

Symbol
Xpo5, 2410004H11Rik, 2700038C24Rik, AI648907, AW549301, Exp5, RanBp21, mKIAA1291
Name
(RefSeq) exportin 5
  KO
K14289  exportin-5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    72322 (Xpo5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    72322 (Xpo5)
   03036 Chromosome and associated proteins [BR:mmu03036]
    72322 (Xpo5)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    72322 (Xpo5)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     72322 (Xpo5)
SSDB
Motif
Pfam: Exportin-5 Xpo1 IBN_N IMD UCH
Other DBs
NCBI-GeneID: 72322
NCBI-ProteinID: NP_082474
MGI: 1913789
Ensembl: ENSMUSG00000067150
UniProt: Q924C1
Position
17; 17 C
AA seq 1204 aa
MEMEQVNALCEELVKAVTVMMDPSSTQRYRLEALKFCEEFKEKCPICVPCGLKLAEKTQI
AIVRHFGLQILEHVVKFRWNSMSRLEKVYLKNSVMELIANGTLRILEEENHIKDVLSRIV
VEMIKREWPQHWPDMLMELDTLFRQGETQRELVMFILLRLAEDVVTFQTLPTQRRRDIQQ
TLTQNMERILNFLLNTLQENVNKYQQMKTDSSQEAEAQANCRVSVAALNTLAGYIDWVSL
NHITAENCKLVETLCLLLNEQELQLGAAECLLIAVSRKGKLEDRKRLMILFGDVAMHYIL
SAAQTADGGGLVEKHYLFLKRLCQVLCALGNLLCALLALDANIQTPINFGMYLESFLAFT
THPSQFLRSSTHMTWGALFRHEVLSRDPALLAVIPKYLRASMTNLVKMGFPSKTDSPSCE
YSRFDFDSDEDFNAFFNSSRAQHGEVVRCVCRLDPKTSFQMAAEWLKYQLSASIDTGPVN
SCSTAGTGEGGFCSIFSPSYVQWEAMTFFLESVINQMFRTLDKEELPVSDGIELLQLVLN
FEIKDPLVLSCVLTNVSALFPFVTYKPAFLPQVFSKLFSFVTFESVGESKAPRTRAVRNV
RRHACSSINKMCRDYPDLVLPNFDMLYSHVKQLLSNELLLTQMEKCALMEALVLVSNQFK
DYERQKLFLEELMAPVVNIWLSEEMCRALSDIDSFIAYVGADLKSCDPAVEDPCGLNRAR
MSFCVYSILGVMRRTSWPSDLEEAKAGGFVVGYTPSGNPIFRNPCTEQILRLLDNLLALV
RTHNTLYTPEMLTKMAEPFTKALDIVESEKTAILGLPQPLLEFNDHPVYRTTLERMQRFF
GILYENCYHILGKAGPSMQQDFYTVEDLASQLLGSAFVNLNNIPDFRLRSMLRVFVKPLV
LFCPSEHYETLISPILGPLFTYLHMRLSQKWHVINQRSILCGEDEIAEDNPESQEMLEEQ
LVRMLTREAMDLIMACCVSKKTADHTAAPTADGDDEEMMATEVAPSSVVELTDLGKCLMK
HEDVCTALLITAFNSLTWKDTLSCQRATTQLCWPLLKQVMSGTLLADAVTWLFTSVLKGL
QMHGQHDGCMASLVHLAFQIYEALRPRYLEIRAVMEQIPEINKESLDQFDCKLLNPSLQK
AADKRRKDHFKRLIAGCIGKPLGEQFRKEVHIKNLPWLFKKPKPMLETEVLDSEEGGLAT
IFEP
NT seq 3615 nt   +upstreamnt  +downstreamnt
atggagatggagcaagtgaacgcgctgtgcgaggagctagtgaaagcggtgacggtcatg
atggaccccagctctacccagcgctaccggctggaagccctcaagttttgtgaagagttt
aaagaaaaatgccctatctgtgttccatgtggcttgaagttggctgaaaaaacacaaatt
gccatcgtcagacattttggccttcagatcctggagcatgttgtcaagtttcgatggaac
agcatgtcccgattggagaaggtctatctgaagaacagtgtcatggagctgatcgcaaat
ggaacactgaggattttggaggaggagaaccacattaaagatgttctgtctagaattgtg
gtagagatgatcaaacgagagtggccacagcactggcctgacatgctcatggagttggat
actctcttcaggcaaggggaaacgcagagggagttggtgatgttcatccttctccgactg
gccgaggatgtagtgacctttcagacgctccccactcaaagaagaagggatattcagcaa
acattgacgcagaacatggaaagaatcttgaattttctactcaatacgcttcaggaaaat
gtaaacaagtaccaacaaatgaagacagattcatctcaggaggcagaggctcaagccaac
tgtcgagtaagcgtggcggccctgaacactctagccggctacattgactgggtatctttg
aaccatatcactgccgagaactgtaaactcgtggagactctgtgcctgcttctcaatgag
caggagctgcagttgggagccgccgagtgtctgctcattgcagtcagcagaaaaggcaag
ctggaggaccggaagcgcttgatgatcctgtttggagatgtcgccatgcattatattctc
tcggccgcacagactgcagatggaggaggcttggtcgaaaaacactacctcttcctgaag
agactttgtcaggtgttatgtgcactgggaaatctgctatgtgcactgctggccttagat
gctaacatacaaacacctataaactttggaatgtacctggaatcttttcttgctttcaca
acccatccaagtcagtttttacgctcttcaacccatatgacgtggggagccctcttcagg
catgaagttctgtcccgtgatccggcactgttagcagtaataccaaaatatcttcgtgct
tctatgacaaacttggtcaagatgggctttccttctaaaacagatagccccagctgtgaa
tattcccgatttgatttcgatagtgatgaggacttcaatgctttcttcaactcctcccga
gcccagcatggagaggtggtgaggtgtgtgtgtcgactggatcctaagactagcttccag
atggcggcagaatggctcaagtatcagctgtcagcttctattgacactggacctgtgaac
tcatgttctacagctggaactggagagggaggcttctgctccatcttctcaccttcatat
gtgcagtgggaagctatgactttttttttggaaagtgtgatcaaccagatgtttcgaaca
ctagacaaagaagagctcccggttagtgatgggatagagctgctgcagctggtgttgaac
tttgaaatcaaggatcccctcgtcctgtcctgcgtcctcactaatgtctcagcgctcttc
ccatttgtcacatacaagcctgcgttcttgccccaggtcttctctaagctcttttcattt
gttacttttgaatctgttggggaaagtaaggcccccaggactcgggcagtcaggaatgta
aggagacatgcttgttcctccatcaacaagatgtgtcgggactacccagaccttgttctg
cccaattttgacatgctttatagccacgtgaagcaactcctctccaatgagctcctcctg
acccagatggagaagtgcgccctcatggaagctctggttctcgttagcaaccaattcaag
gattatgagcggcagaagttattcctagaggagctgatggcaccggtggtcaacatctgg
ctttctgaagaaatgtgcagagcgctgtcagatattgactccttcattgcctatgtgggt
gctgatctgaaaagctgtgacccagctgtggaggatccatgtggcttgaaccgtgcacga
atgagcttttgtgtgtacagcatcctgggggttatgagacgcactagctggccttccgac
ctagaagaagccaaagctgggggctttgtggtgggctacacacccagtggaaatcccatc
ttccgtaacccctgcacagagcagatcctcagacttctcgacaatttgcttgcccttgta
agaactcacaatactttatatacaccggaaatgctaacgaaaatggcagaacctttcacc
aaggctctggatatagttgaatctgaaaaaacggcaatattaggattacctcagcctctc
ttggaattcaacgaccaccctgtctatagaaccactctggagaggatgcagcggttcttt
ggcattctctatgaaaactgttaccatatcctagggaaggcaggcccttccatgcagcaa
gatttctacactgtggaggaccttgcttcccagctccttggatcagctttcgtcaacttg
aacaatattcctgacttccggcttagatctatgcttcgtgtcttcgtgaagcccctcgtg
ctcttctgcccctcagaacactatgaaaccctgatatctcccatccttggacctctcttc
acctacctccacatgaggctctctcagaagtggcatgtcatcaaccagaggagcatcctg
tgtggagaagatgagattgcagaggacaaccccgagtctcaggaaatgctcgaggaacag
ctggtgaggatgctcacccgagaagccatggacctaatcatggcttgctgtgtgtcgaag
aagactgccgaccacacagccgctcccactgcagatggagatgatgaagagatgatggcc
actgaagtagccccctcgtctgtggtggagctcacagacctgggcaaatgcctcatgaag
cacgaggatgtctgcacagcactgctaatcacagcatttaattctctgacctggaaggac
acactgtcttgccagagggctaccacacagctctgctggcccctcctcaaacaggtgatg
tctgggaccctgctcgcagacgctgtcacttggcttttcaccagtgtgctgaaaggactg
cagatgcacgggcagcacgatgggtgcatggcttccctggtccacttggccttccagata
tacgaggcgctgcgccccaggtacctagagataagagcagtaatggagcagatccctgaa
ataaacaaggagtctctggaccaatttgactgcaagcttttaaacccctcccttcaaaaa
gcagctgataaacgacggaaggaccacttcaaacgtctaatcgctggctgcattgggaaa
cccttgggagaacagttccgaaaagaagttcacattaagaaccttccctggcttttcaaa
aaacccaaaccaatgttggagacagaagtgctggacagtgaggagggtggactggccacc
atctttgaaccctga

DBGET integrated database retrieval system