KEGG   Mus musculus (mouse): 72323
Entry
72323             CDS       T01002                                 

Gene name
Asb6, 2510004M11Rik, AA409356
Definition
(RefSeq) ankyrin repeat and SOCS box-containing 6
  KO
K10328  ankyrin repeat and SOCS box protein 6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    72323 (Asb6)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     72323 (Asb6)
SSDB
Motif
Pfam: Ank_4 Ank Ank_5 Ank_2 Ank_3 SOCS_box
Other DBs
NCBI-GeneID: 72323
NCBI-ProteinID: NP_579924
MGI: 1919573
Ensembl: ENSMUSG00000039483
Vega: OTTMUSG00000011879
UniProt: Q91ZU1
Position
2; 2 B
AA seq 418 aa
MPFLHGFRRIIFEYQPLVDAILGALGIQDLERQEPLDDSASSEESRILVLTELLEQKAHS
PFYQEGVSNALLKMAELGLTRAAAVLLQSGANLNFEDPVTYYTALHIAVLRNQPDMVELL
VRHGADINRRDRIHESSPLDLASEEPERLPCLQRLLDLGADVNAADKNGKTALLHALASS
DGVQIHNTENIRLLLEGGADVKATTKDGDTVFTCIIFLLGETVCGDKEEAPMINRFCFQV
TQLLLAHGADPSECPAHESLTHICLKSFKLHFPLLCFLLESGAAYNCSLHGASCWSGFNL
VFERLCSHPGCAEDDSHIELLHKAETVLDLMVTSSQRLQLPENLNIHPVGSLAGKIQALH
ASLRQLESYPPPLKHLCRVSIRLCLRPWPVDTKVKALPLPDRLKWYLLSAHSDTQDTC
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgccgttcttgcacggcttccgcaggatcatctttgagtaccagcccctagtggacgcc
atccttggcgccctgggcatccaggatctggagcggcaggagcccctggatgattctgct
tccagcgaggagagccggatcctggtcctcacggagctgctggagcagaaggctcactct
ccattctaccaggaaggcgtgagcaatgcgttgctgaagatggctgagctgggcctgacc
cgggcagctgctgtccttctgcagagtggggccaacctcaatttcgaagaccctgttacc
tactacacagccctgcacattgctgtcctgagaaaccagcctgacatggttgagctgctg
gtgcgccacggggctgacatcaacaggagggaccggatccatgagagcagccccttggat
ctggccagcgaggaacccgaacgcctgccctgcctgcagcgcctcttggatcttggagca
gatgtcaatgcagctgacaagaatgggaagacagctttacttcacgccctggccagcagc
gatggtgtgcagatccacaacacagaaaacatccggctcctcctggagggaggggcagac
gtcaaggccaccaccaaggatggggacactgtattcacctgcatcatcttcctgctcggt
gagactgtctgtggggacaaggaggaggccccgatgatcaaccgcttctgcttccaagtc
acgcagctcttgctggcccacggtgccgaccccagcgagtgcccggcccatgagtccctc
acgcacatctgcctcaagagcttcaagctgcacttcccgctcctctgcttcctgctggag
tccggagccgcctacaactgctccctgcacggtgcatcctgttggtctggcttcaacctc
gtttttgagaggctctgctcgcacccgggctgtgccgaggacgacagccacattgagctt
ctgcataaggctgagaccgtgctggacctcatggtgaccagctcccagaggctgcagctg
cctgagaacctcaacatccacccagtgggtagcctggcagggaagatccaggcccttcat
gcctccctgaggcagctcgagagctacccgccacctctcaaacacctgtgccgggtgtcc
atccggctgtgcctgcgaccgtggcctgtggacaccaaggtcaaagcactgcccttgccc
gacaggctcaagtggtacctgctcagtgcacacagtgatacccaagacacttgctga

DBGET integrated database retrieval system