KEGG   Mus musculus (mouse): 72388
Entry
72388             CDS       T01002                                 

Gene name
Ripk4, 2310069J12Rik, AI552420, ANKK2, Ank, Ankrd3, DI, DIk, PK, PKK, R, RIP4
Definition
(RefSeq) receptor-interacting serine-threonine kinase 4
  KO
K08848  receptor-interacting serine/threonine-protein kinase 4 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    72388 (Ripk4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     72388 (Ripk4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   72388 (Ripk4)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3 Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 72388
NCBI-ProteinID: NP_076152
MGI: 1919638
Ensembl: ENSMUSG00000005251
Vega: OTTMUSG00000019977
UniProt: Q9ERK0
Structure
PDB: 
5WNL 5WNJ 5WNM 5WNI 5WNK

Position
16; 16 C4
AA seq 786 aa
MEGEGRGRWALGLLRTFDAGEFAGWEKVGSGGFGQVYKVRHVHWKTWLAIKCSPSLHVDD
RERMELLEEAKKMEMAKFRYILPVYGICQEPVGLVMEYMETGSLEKLLASEPLPWDLRFR
IVHETAVGMNFLHCMSPPLLHLDLKPANILLDAHYHVKISDFGLAKCNGMSHSHDLSMDG
LFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKNILHIMMKVVKGH
RPELPPICRPRPRACASLIGLMQRCWHADPQVRPTFQEITSETEDLCEKPDEEVKDLAHE
PGEKSSLESKSEARPESSRLKRASAPPFDNDCSLSELLSQLDSGISQTLEGPEELSRSSS
ECKLPSSSSGKRLSGVSSVDSAFSSRGSLSLSFEREASTGDLGPTDIQKKKLVDAIISGD
TSRLMKILQPQDVDLVLDSSASLLHLAVEAGQEECVKWLLLNNANPNLTNRKGSTPLHMA
VERKGRGIVELLLARKTSVNAKDEDQWTALHFAAQNGDEASTRLLLEKNASVNEVDFEGR
TPMHVACQHGQENIVRTLLRRGVDVGLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVN
AQTLDGRTPLHLAAQRGHYRVARILIDLCSDVNICSLQAQTPLHVAAETGHTSTARLLLH
RGAGKEALTSEGYTALHLAAQNGHLATVKLLIEEKADVMARGPLNQTALHLAAARGHSEV
VEELVSADLIDLSDEQGLSALHLAAQGRHSQTVETLLKHGAHINLQSLKFQGGQSSAATL
LRRSKT
NT seq 2361 nt   +upstreamnt  +downstreamnt
atggagggcgagggccggggccggtgggctctggggctgctgcgcaccttcgacgccggc
gaattcgcaggctgggagaaggtgggctcgggcggcttcgggcaggtgtacaaggtgcgc
catgtgcactggaagacgtggctcgcgatcaagtgctcgcccagtctgcacgtcgacgac
agggaacgaatggagctcctggaggaagctaagaagatggagatggccaagttccgatac
attctacctgtgtacggcatatgccaggaacctgtcggcttggtcatggagtacatggag
acaggctccctggagaagctgctggcctcagagccattgccttgggacctgcgctttcgc
atcgtgcacgagacagccgtgggcatgaacttcctgcattgcatgtctccgccactgctg
cacctagacctgaagccagcgaacatcctgctggatgcccactaccatgtcaagatttct
gactttgggctggccaagtgcaatggcatgtcccactctcatgacctcagcatggatggc
ctgtttggtacaatcgcttacctccctccagagcgaattcgtgagaagagccgcttgttt
gacaccaaacatgatgtatacagcttcgccattgtgatctggggtgtgcttacacagaag
aagccatttgcagatgaaaagaacatcctacacatcatgatgaaagtggtaaagggccac
cgcccagagctgccacccatctgcagaccccggccgcgtgcctgtgccagcctgataggg
ctcatgcaacggtgctggcatgcagacccacaggtgcggcccaccttccaagaaattacc
tctgaaacagaagacctttgtgagaagcctgatgaggaggtgaaagacctggctcatgag
ccaggcgagaaaagctctctagagtccaagagtgaggccaggcccgagtcctcacgcctc
aagcgcgcctctgctccccccttcgataacgactgcagtctctccgagttgctgtcacag
ttggactctgggatctcccagactcttgaaggccccgaagagctcagccgaagttcctct
gaatgcaagctcccatcgtccagcagtggcaagaggctctcgggggtgtcctcagtggac
tcagccttttcctccagaggatcgctgtcactgtcttttgagcgggaagcttcaacaggc
gacctgggccccacagacatccagaagaagaagctagtggatgccatcatatcaggggac
accagcaggctgatgaagatcctacagccccaagatgtggacttggttctagacagcagt
gccagcctgctgcacctggctgtggaggccggacaggaggagtgtgtcaagtggctgctg
cttaacaatgccaaccccaacctgaccaacaggaagggctctacaccactgcatatggct
gtggagcggaagggacgtggaattgtggagctactgctagcccggaagaccagtgtcaat
gccaaggatgaagaccagtggactgccctgcactttgcagcccagaatggggatgaggcc
agcacaaggctgctgctagagaagaatgcttctgtcaatgaggtggactttgagggccga
acacccatgcatgtagcctgccagcatggacaggagaacattgtgcgcaccctgctccgc
cgtggtgtggatgtgggcctgcagggaaaggatgcctggttgcctctgcactatgctgcc
tggcagggccaccttcccattgttaagctgctagccaagcagcctggggtgagtgtgaat
gcccagacactagacgggaggacacccctgcacctggctgctcagagggggcattaccgt
gtggctcgcattctcattgacctgtgctctgatgttaacatctgcagcctacaggcacag
acacctctgcatgttgctgcagagactggacacactagtactgccaggctactcttgcat
cgtggtgctggcaaggaggctttgacctcagagggctatactgccttgcacctggcagcc
cagaatggacacctggctactgtcaagctgctcatagaggagaaggctgatgtgatggct
cggggtcccctgaatcagacagcactgcacctggctgctgcccgtggacactcagaggtg
gtagaagagctggtcagtgctgacctcattgacctgtctgatgagcagggcctcagcgca
ctgcacctggctgctcagggcaggcattcacagactgtggagacactgctcaaacatgga
gcacacatcaacttgcagagtctcaagttccaaggaggccagagctctgctgccacgttg
ctccgacgcagcaagacctag

DBGET integrated database retrieval system