KEGG   Mus musculus (mouse): 72392
Entry
72392             CDS       T01002                                 

Gene name
Tmem175, 3010001K23Rik, AI504381, mTMEM175
Definition
(RefSeq) transmembrane protein 175
  KO
K24915  TMEM175 potassium channel family protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    72392 (Tmem175)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   72392 (Tmem175)
Motif
Pfam: DUF1211 DUF1129
Other DBs
NCBI-GeneID: 72392
NCBI-ProteinID: NP_001157004
MGI: 1919642
Ensembl: ENSMUSG00000013495
Vega: OTTMUSG00000026815
UniProt: Q9CXY1 Q8BM80
Position
5; 5 F
AA seq 499 aa
MSRLQTEEQAVDSEGDSSLHRRNEEGTQSSHRMLGFSDALLSIIATVMILPVTHTEISPE
QQFDKSIQKLLATRIAVYLMTFLIVTVAWTAHTRLFQVVGKIDDTLALLNLACMMTITLL
PYTFSLMVTFPDVPLGIFLFCVCVIAIGSVQAMIVGYAFHFPHLLNPQIQCSTHRDLSRR
HILHLVLRGPALCFVAAVFSLFFFPLSYLLMVTVIFLPHISKATTWCKDKLMGQRESPAH
DMEPFSIDLHAPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVQEKFSGSLVAAL
GAYGPQFLAYFGSFATVGLLWFAHHSLFLHVRKATQTMGLLNILSLAFVGGLPLAYQQTS
AFARQPHDELERVRVSCAIIFFASIFQFAIWTTALLHQTETLQPAVQFGGQEHAFMFAKL
ALYPCASLLAFAATCLLSRFSTAIFHLMQISVPFAFLLLRLLVRLALAGLQVLRGLWPHH
PQQDQSEPEAQSQLLPDPC
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgtccaggctccagactgaggagcaggcagtggattccgagggagactcatccctacac
aggagaaatgaggaggggacacagagctcccaccgcatgctgggcttcagtgatgcactg
ctgtccatcatcgccactgtcatgatcctgcctgtgacccacacagagatctcaccagaa
cagcagtttgacaaaagtatacagaaactcctagcaactaggatcgctgtctacctcatg
acatttctaatcgtaactgtggcctggacagcacataccagattgttccaggttgttgga
aaaatagatgatacacttgccttgctcaacctggcctgtatgatgactatcaccctcctg
ccctacacattttcactaatggtaacattccctgatgtgcccctgggcatcttcctgttc
tgcgtgtgtgtgatcgccattggatctgtgcaggcaatgattgtgggctatgccttccac
ttcccacatctgctgaatccacaaatccagtgctctacacatagggatctatcccggcgg
catatcctgcacctggtcctccgtggcccagcactgtgttttgttgcggctgtcttttcc
ctcttcttcttccccttgtcatacctgctgatggtgactgtcatcttcctccctcacatc
agcaaggctaccacctggtgcaaagacaagttgatgggccaaagggagtctccagctcac
gacatggagcccttcagtattgacctgcatgcgcccctcagcaaagagcgggtggaagct
ttcagcgacggtgtctatgccatcgtggccacactcctcatcctggacatctgtgaggac
aatgttccggatcccaaggatgtgcaagagaaattcagtggcagccttgtggctgccctg
ggtgcatatgggccacaattcttggcatacttcggctccttcgccacagtgggtctcctc
tggtttgctcaccattcactcttcctgcatgtccggaaggctacacagaccatggggtta
ctcaacatactatcgctggcctttgtgggtggccttcctctggcctaccagcagacctca
gcttttgcccggcaaccccatgatgaacttgagcgtgtgcgtgtcagctgtgccatcatc
ttctttgccagcatcttccagtttgccatctggactacagccctgctgcatcagacagaa
acactgcagccagctgtgcaatttggtgggcaggagcatgctttcatgtttgccaagctt
gcactgtatccctgtgccagcctgctggcctttgctgccacctgcctactgagtcgtttc
agcacagccatcttccacctcatgcagatttcagtgccctttgcattcctgttgctccgt
ctccttgtacgccttgccctggcaggccttcaagtcctacggggcctctggccacaccat
ccccaacaagaccagagtgaacctgaggcacagtcccagctcttgcctgacccctgctaa

DBGET integrated database retrieval system