KEGG   Mus musculus (mouse): 72421
Entry
72421             CDS       T01002                                 

Symbol
Ttc30b, 2510042P03Rik, Tcc30b
Name
(RefSeq) tetratricopeptide repeat domain 30B
  KO
K19683  tetratricopeptide repeat protein 30
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    72421 (Ttc30b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    72421 (Ttc30b)
SSDB
Motif
Pfam: TPR_19 TPR_2 TPR_1 TPR_7 TPR_16 ANAPC3 SRP_TPR_like TPR_8 HrpB1_HrpK TPR_6
Other DBs
NCBI-GeneID: 72421
NCBI-ProteinID: NP_082511
MGI: 1919671
Ensembl: ENSMUSG00000075273
Vega: OTTMUSG00000015168
UniProt: Q9CY00 B2RXA2
Position
2:complement(75766193..75768806)
AA seq 664 aa
MAGLSSSQIPDGEFTAVVYRLIRDSRYSEAVQLLSAELQRSSRSRAGLSLLAYCYYRLQE
FELAAECYEQLSQMHPELEQYRLYQAQALYKACLYPEATRVAFLLDNPAYQTRVLRLQAA
IKYSEGDLPGARSLVEQLLSGEGVEDSGGESDYDGQINLGCLLYKEGHYEAACSKFLAAL
QASGYQPDLSYNLALAYYSSRQYAPALKHIADIIERGIRQHPELGVGMTTEGIDVRSVGN
TIVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDAK
PTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDF
LDAMITCQTAPEEAFIKLDGLAGMLTEQLRKLTIQVQDSRHSRDDESAKKAVNEYDETLE
KYIPVLMAQAKIYWNFENYPMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGF
YEPIVKKNYDNILSVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYGDPDKKIY
HLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYHKKLGTDTWYYAKRCFLSLLENMSKHT
IMLRDSVIQECVQFLEHCELYGRNIPAVIEQPLEEERMHTGKNTVTYESRKLRALIYEII
GWNV
NT seq 1995 nt   +upstreamnt  +downstreamnt
atggcagggctgagcagctcacagatccccgacggtgagttcacagcagtggtgtacagg
ctcatccgcgactcccgctactcagaggcggtgcagctgctgagcgcagagctgcagagg
agctcccgcagccgcgcagggctgtcgctgctggcctactgctactaccgcctgcaggag
ttcgagctcgctgcagagtgctatgagcagctgagccagatgcacccggaactcgagcag
taccgcctgtaccaggcccaggcactgtacaaggcctgcctgtatccagaggccaccagg
gtcgccttcctcctggacaaccccgcctatcagactcgagtccttcgtctccaggctgct
atcaagtacagtgaaggtgacctcccaggagccaggagcctggtggagcagctgctgagt
ggggaaggtgtagaggacagtggaggggagagtgattatgatggtcagatcaacctaggt
tgtctgctctacaaagagggacactatgaagctgcctgttccaagttcttagcggccctg
caggcttctggctaccagcctgacctttcctacaacttggctttggcctattacagcagt
cggcagtacgcgcctgctctgaagcatatcgctgacatcattgagcgtggcatccgtcaa
cacccagaactcggtgtgggcatgaccacggagggcattgatgttcgcagtgttggcaac
actatagtccttcaccagactgctctggtcgaagccttcaacctcaaggcagccatagag
taccagctgagaaactacgaggcagcccaggaagccctcactgacatgccacccagagca
gaggaagagctggaccccgtaaccctccacaaccaggctctgatgaacatggatgccaag
cccacagagggctttgaaaagctccagtttctgctccagcagaaccccttccccccagag
acctttggcaacctgctgctgctctactgtaaatatgagtattttgacctggcagctgat
gtcctggcagaaaatgcccacttgacttacaagttcctcacaccctatctctatgacttc
ttggatgccatgatcacttgccagacagctcctgaagaggctttcattaaacttgatggg
ttggctggcatgctgactgagcagctccggaaactcaccatacaagtacaggattcaagg
catagtagagatgatgaatctgccaaaaaggctgtgaatgaatatgatgaaactcttgag
aagtatattcctgtactgatggcccaggcaaaaatctactggaactttgagaattaccca
atggtggagaagatcttccgcaaatctgtggaattctgtaatgaccatgatgtgtggaag
ctgaatgtggcccatgtcctcttcatgcaggagaacaagtacaaagaggccattggtttc
tatgagcccattgtcaagaagaattatgataacatcctgagtgtcagtgctattgtgtta
gccaacctctgtgtttcctatatcatgacaagtcaaaatgaggaagctgaggagctcatg
aggaagattgagaaggaggaggaacaactctcttatggtgacccagacaagaaaatctac
cacctttgcattgtgaatttggtgataggaactctgtattgtgccaaaggaaactatgac
tttggcatctctcgggttatcaaaagcctggagccttaccataaaaagctaggcaccgat
acatggtattatgccaagagatgtttcctgtccttactagagaacatgtcaaagcacaca
attatgctaagggacagtgtcattcaagaatgtgtgcagtttctagagcactgtgaactt
tatggtagaaacattccagctgttatagaacagcccttggaggaagaaagaatgcacact
gggaagaatacagtcacatatgaatcaagaaagttgagggctctgatttatgagataatt
ggatggaatgtgtaa

DBGET integrated database retrieval system