KEGG   Mus musculus (mouse): 72446
Entry
72446             CDS       T01002                                 

Gene name
Prr5l, 2600010E01Rik, 4833411O04Rik, Protor-2, Protor2
Definition
(RefSeq) proline rich 5 like
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: HbrB
Other DBs
NCBI-GeneID: 72446
NCBI-ProteinID: NP_001077279
MGI: 1919696
Ensembl: ENSMUSG00000032841
Vega: OTTMUSG00000015047
UniProt: A2AVJ5
Position
2; 2 E2
AA seq 370 aa
MTRGLAPLLPIEFHKMGSFRRPRPRFMSSPVLSELPRFQAARQALQLSSNSAWNSVQTAV
INVFKGGGLQSNELYALNESIRRLLKSELGSFITDYFQNQLLAKGLSFVEEKIKLCEGDN
RIEVLAEVWDHFFTETLPTLQAIFYPVQGQELTIRQISLLGFRDLVLLKVKLGDVLLLAQ
SKLPSSVIQMLLILQSVHEPTGPSEGYLQLEELVKQVVSPFLSISGDRSCSGPTYSLARR
HSRVRPKVTVLNYASLMTTVGRPLNEMVLTPLTEQEGEAYLEKCGSVRRHTVANAHSDIQ
LLAMATMMHSGLGEEAGGEDKHLLLPPSFPPPHRQCSSEPSILDSPDELELEDVASGSQE
DSELNCASLS
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgacccgcggcctcgctcccctcctgcccattgaattccacaagatgggctccttccgc
cggcctagaccacgctttatgagctcccctgtgctcagcgagctgccccgcttccaggct
gcccggcaggctctgcagctaagttccaactctgcctggaacagtgtgcagacagctgtg
atcaacgttttcaaagggggcggcttgcagagcaatgagctgtatgcactgaacgaaagc
atcaggcggctgctgaagagtgaacttggatcattcattactgactatttccagaaccag
cttcttgcaaaaggactgtcctttgtggaggagaagatcaagctgtgtgaaggtgacaat
cggattgaggttctggctgaagtctgggaccacttcttcaccgagactctccctaccctg
caggcaatattttatccggttcagggacaggagctgaccatccgccagatctccctgctg
ggcttccgggacctggtcttgctgaaggtgaagctgggtgacgtgctgctgttggcacag
tccaagttgccttcttctgttatacaaatgctgctcattctgcagagtgttcacgagccc
acaggcccaagtgagggctacttgcagctggaggagctggtgaagcaagtggtgtctccc
tttctcagcatcagcggggaccgcagctgctcaggccccacgtactcactggccaggagg
cattccagggtccggcccaaggtgactgtcctgaactatgcctctctgatgaccacggtt
ggccggccactgaacgagatggtcttgacccctctaacagaacaggaaggggaggcatac
ctggagaagtgtggcagtgtccggcggcacacagtggccaacgcccactcagacatccag
ctgctggcgatggccaccatgatgcactcagggttgggggaggaggctggcggcgaggac
aaacacctgctcttgccacccagcttccccccaccacaccgccagtgctccagtgaaccc
agcatcctcgacagccccgatgaactggaactagaagacgtggcaagtggcagccaggag
gactcagagctgaactgtgcttccctcagctga

DBGET integrated database retrieval system