KEGG   Mus musculus (mouse): 72461Help
Entry
72461             CDS       T01002                                 

Gene name
Prcp, 2510048K03Rik, 2610104A14Rik, AI451719, HUMPCP, PCP
Definition
(RefSeq) prolylcarboxypeptidase (angiotensinase C)
  KO
K01285  lysosomal Pro-X carboxypeptidase [EC:3.4.16.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04614  Renin-angiotensin system
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    72461 (Prcp)
  09154 Digestive system
   04974 Protein digestion and absorption
    72461 (Prcp)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    72461 (Prcp)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.2  lysosomal Pro-Xaa carboxypeptidase
     72461 (Prcp)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S28
   72461 (Prcp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S28 Hydrolase_4 Peptidase_S37 Abhydrolase_6 DUF2920 Peptidase_S9 Abhydrolase_1
Motif
Other DBs
NCBI-GeneID: 72461
NCBI-ProteinID: NP_082519
MGI: 1919711
Ensembl: ENSMUSG00000061119
Vega: OTTMUSG00000059925
UniProt: Q7TMR0
Position
7; 7 E1
AA seq 491 aa AA seqDB search
MGCRALLLLSFLLLGAATTIPPRLKTLGSPHLSASPTPDPAVARKYSVLYFEQKVDHFGF
ADMRTFKQRYLVADKHWQRNGGSILFYTGNEGDIVWFCNNTGFMWDVAEELKAMLVFAEH
RYYGESLPFGQDSFKDSQHLNFLTSEQALADFAELIRHLEKTIPGAQGQPVIAIGGSYGG
MLAAWFRMKYPHIVVGALAASAPIWQLDGMVPCGEFMKIVTNDFRKSGPYCSESIRKSWN
VIDKLSGSGSGLQSLTNILHLCSPLTSEKIPTLKGWIAETWVNLAMVNYPYACNFLQPLP
AWPIKEVCQYLKNPNVSDTVLLQNIFQALSVYYNYSGQAACLNISQTTTSSLGSMGWSFQ
ACTEMVMPFCTNGIDDMFEPFLWDLEKYSNDCFNQWGVKPRPHWMTTMYGGKNISSHSNI
IFSNGELDPWSGGGVTRDITDTLVAINIHDGAHHLDLRAHNAFDPSSVLLSRLLEVKHMK
KWILDFYSNIQ
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgggctgccgggctctcctgctcctgtctttcctattactcggggccgccacaaccatc
ccgcctaggctaaagaccctcggcagcccgcatttgtcagccagtcccacacccgaccct
gctgtagcccgtaaatactcagttctttacttcgaacagaaggttgaccactttgggttt
gctgacatgagaacttttaaacagcggtacctagtcgctgataaacactggcagagaaat
ggtggatcaatacttttctacactggtaacgaaggggacattgtctggttttgcaataat
acggggttcatgtgggatgtggctgaggagctgaaagctatgctggtgttcgctgagcat
cgatactatggggagtcccttccctttggtcaggactccttcaaggattcccaacacttg
aatttcctgacatcagaacaggctctggctgattttgcagagttaatcagacacttggaa
aaaacaatcccaggagctcaaggtcaacctgtcatcgccatcgggggctcttatggtggc
atgcttgcagcctggttcaggatgaagtatcctcacattgtagttggagctcttgcagct
tctgcccctatctggcagcttgatggtatggttccctgtggtgagtttatgaagattgta
actaacgatttcaggaaaagtggtccttattgttcagaaagtatccgcaaatcctggaat
gtcattgacaaactctcaggttcaggcagtggtctccagtcgctcacgaacattcttcac
ctatgtagtcccttgacttctgagaaaatcccaactttaaaaggatggatagctgagacc
tgggtgaacctggccatggtgaactacccttacgcatgcaactttttgcagcctttgcct
gcttggcccatcaaggaggtgtgccaatatttgaaaaatcctaatgtatcggatacagtg
ctgctgcagaatattttccaagctctgagtgtatattataactattcaggccaagcagca
tgcctgaatatttcacaaacgactacgagcagtctgggctccatgggctggagctttcag
gcctgcacagaaatggtcatgcccttttgtactaatggtattgatgacatgtttgaaccc
tttctgtgggacttggagaagtattccaatgactgttttaaccagtggggagtgaaacca
cggcctcattggatgactaccatgtacggtggcaaaaacatcagttcacactcaaacatc
attttcagcaatggtgagttagacccgtggtcaggaggtggagtaaccagagacatcaca
gacaccctggtggctatcaacatccatgacggggcccatcatttagatctccgagcccac
aacgccttcgatccttcctctgtgctgttatctcgattattggaagttaaacacatgaag
aaatggattttagatttctatagcaatatccaatga

DBGET integrated database retrieval system