KEGG   Mus musculus (mouse): 72479Help
Entry
72479             CDS       T01002                                 

Gene name
Hsdl2, 2610207I16Rik
Definition
(RefSeq) hydroxysteroid dehydrogenase like 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 SCP2 KR Alkyl_sulf_C DUF2000
Motif
Other DBs
NCBI-GeneID: 72479
NCBI-ProteinID: NP_077217
MGI: 1919729
Ensembl: ENSMUSG00000028383
Vega: OTTMUSG00000007335
UniProt: Q2TPA8
Position
4; 4 B3
AA seq 490 aa AA seqDB search
MLPNTGKLAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTTQKHPKLLGTIYTAAEE
IEAAGGTALPCVVDVRDEQQINSAVEKAVEKFGGIDILVNNASAISLTNTLDTPTKRVDL
MMNVNTRGTYLTSKACIPFLKKSKVGHILNLSPPLNLNPLWFKQHCAYTIAKYGMSMCVL
GMAEEFRGEIAVNALWPRTAIHTAAMDMLGGSGVENQCRKVDIIADAAYSIFKRPKSFTG
NFIIDENILKEEGIKNFDVYAIAPGHPLLPDFFLDEHPDAVMEEKESNDSVPEVKEEKLQ
LQEESQLQKQPQLQEQPQLQEKPQLQEKPQLQEQPQLQEKPQLQEQPQQREQPQLQQQPR
PRQQPQPFVQSMLPQKPHFGAVEETFRIVKDSLSDEVVRATQAVYQFELSGEDGGTWFLD
LKSKGGKVGHGEPSDRADVVMSMATDDFVKMFSGKLKPTMAFMSGKLKIKGNIALAIKLE
KLMTQMNSRL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccaacactgggaagctagcgggatgcacagtttttatcacaggtgcaagccga
ggcattggcaaagcaattgccttgaaagccgcaaaggatggagccaatattgtcattgct
gcgaagaccacccaaaagcacccgaaactcctcggcacaatctacacggctgctgaagaa
attgaagcagctggagggacggccttgccttgtgttgttgatgtgagagatgaacagcaa
atcaacagtgcagtggagaaagctgtggagaaatttggaggaattgatattttggtgaac
aatgccagtgctattagcttgaccaacacgttggacactccgaccaagagagtggacttg
atgatgaatgtgaacaccaggggcacctaccttacatccaaagcatgtattcctttttta
aaaaagagcaaagtaggtcatattctcaatctcagcccacccctgaacctaaacccactg
tggttcaaacagcactgtgcttataccattgccaaatatggcatgtctatgtgtgtgctt
gggatggctgaagaatttagaggtgaaattgcagtcaatgccttatggcctagaacagcc
attcacactgctgctatggatatgctgggaggatctggtgttgaaaaccaatgtagaaaa
gttgacatcattgcggacgctgcatattccattttcaaaaggccaaaaagttttactggc
aactttattattgatgaaaatatcttaaaagaagaaggaataaaaaattttgatgtctac
gcaattgcaccaggtcatcccttgttaccggatttcttcttagatgaacacccagatgca
gttatggaggagaaagaatcaaatgactctgtgccagaagtgaaagaagagaagctgcag
ctgcaggaggagtcacagctacagaagcagccacagctgcaggagcagccacagctgcag
gagaagccacagctgcaggagaagccacagctgcaggagcagccacagctgcaggagaag
ccacagctgcaggagcagccacagcaacgggaacagccacagctgcagcagcagccacgg
ccacggcaacagccacagccatttgtgcagtcaatgctaccacaaaaaccacattttgga
gctgtggaagaaacatttagaattgttaaggactctctcagtgatgaagttgttagagcg
acacaagctgtctatcagtttgaactctcaggtgaagatggtggtacgtggtttcttgat
ctaaagagcaaaggcgggaaggttggacacggagagccctctgaccgggcagacgtggtg
atgagtatggccactgatgattttgtcaaaatgttttcagggaaattaaagccaaccatg
gcatttatgtcaggaaagttgaagattaaaggaaacatagccctagcaatcaaattggag
aagctaatgacccagatgaattctagactatga

DBGET integrated database retrieval system