KEGG   Mus musculus (house mouse): 72500
Entry
72500             CDS       T01002                                 
Symbol
Ier5l, 2610524G09Rik
Name
(RefSeq) immediate early response 5-like
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: IER
Other DBs
NCBI-GeneID: 72500
NCBI-ProteinID: NP_084520
MGI: 1919750
Ensembl: ENSMUSG00000089762
Position
2:complement(30362643..30364211)
AA seq 406 aa
MECALDAQSLISISLRKIHSSRTQRGGIKLHKNLLVSYVLRNARQLYLSERYAELYRRQQ
QQQQQQPPHHQHQHLAYAAPGMPASAADFGPLQLGGGGDAEAREPVARHQLHQLHQLHQL
HLQQQLHQHQHPAPRGCTAAAPVAVAGAPAGCAGALSELPGCAALQPPHGAPHRGQHLEP
LQPGPAPLPPPAPAALCPRDPRVPAACSAPSVLPGAAPSTVAASSPPASTAPSSSTGFYR
GAYPAPSDFGVHCSSQTTVLDLDTHVVTTVENGYLHQDCCASAHCPCCGQGAPGPGLASA
AGCKRKYYPGQEEEDDEEDAGDLGAEPPGGTPFAPCKRARFEDFCPDSSPDASNISNLIS
IFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVAF
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggagtgcgccctggacgcccagagcctgatcagcatctccctgcgcaagatccacagc
tcccggacccagcgcggcggcatcaagctgcacaagaacctcctggtgtcctacgtgctc
cgcaacgcgcgccagctctacctgagcgagcgttacgccgagctctaccggcgccagcag
cagcagcagcaacagcagccgccccaccaccagcaccagcacctcgcttacgcggcgccc
ggaatgccggccagcgcggccgacttcggcccgctccaacttggcggcggcggggacgcg
gaggcgcgcgagccggttgcccggcaccagctgcaccagctccaccagcttcaccagctg
cacctccagcagcagctgcaccaacaccaacacccggcgcccaggggctgcacggcggcg
gcgccggtggcggtggccggggcgcccgcgggctgcgcgggggcgctctcggagctgccc
gggtgcgctgcgctccagccgccgcacggcgcgccccaccgcgggcagcacttggagccg
ctgcagccgggtcccgcgccgctgccgccgcccgcgcccgccgcgctctgcccgcgggac
cctcgcgtcccggccgcttgctctgcgccctcggtgcttccgggggctgccccttcgacc
gtcgctgcctcctctccgcccgcctctacagccccttcctcatccactggcttctaccgg
ggcgcgtacccggccccctcggacttcggcgtgcactgcagcagccagaccaccgtgctg
gacctggacactcacgtggtgaccacggtagaaaacggctacttgcaccaggactgctgc
gcctccgcccactgcccctgctgtggccagggcgctccgggacccggtctggcgtccgcc
gctggttgcaagcgcaagtattaccctggccaggaggaagaggacgacgaagaggacgcg
ggcgacctgggagccgagccccccgggggtaccccattcgccccctgtaagcgcgcccgc
ttcgaggacttctgcccggactcgtccccggacgcgtccaacatctcaaacttgatctcc
atctttggctcgggcttctcggggctggtgagccgacagccggactcctcggagcagccg
ccgccgctcaacgggcagctgtgcgccaagcaggcgctcgccagcctcggcgcctggact
cgagccattgtcgccttctag

DBGET integrated database retrieval system