KEGG   Mus musculus (house mouse): 72514
Entry
72514             CDS       T01002                                 
Symbol
Fgfbp3, 2610306H15Rik, Fgf-bp3
Name
(RefSeq) fibroblast growth factor binding protein 3
  KO
K25535  fibroblast growth factor-binding protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    72514 (Fgfbp3)
SSDB
Motif
Pfam: FGF-BP1
Other DBs
NCBI-GeneID: 72514
NCBI-ProteinID: NP_082539
MGI: 1919764
Ensembl: ENSMUSG00000047632
UniProt: Q1HCM0 A0A0R4J0R6
Position
19:complement(36894950..36896999)
AA seq 250 aa
MANAGMSPPRPRASLSPLTLLLLLGGCLLSAAGRDKGAAGREVTRASRPTVGSSGRFVSP
EQHACSWQLLVPAPGTPTGGELALRCQTPGGASLHCAYRGHPERCAATGARRAHYWRRLL
GALRRRPRPCLDPAPLPPRLCARKTAGSDLHSPAHPSLPARPSEPPRSRARSPARSRQSV
RSPSSQPEKKPLLVKSNSGGRKAGSDPVPEPPAAAGFQPNGLDQNAELTETYCTEKWHSL
CNFFVNFWNG
NT seq 753 nt   +upstreamnt  +downstreamnt
atggccaacgcgggcatgagtcctccgaggccgcgggcgtcgctctccccgctgacgctg
ctgttgctgctgggaggctgcctcctctcggctgccgggagggacaagggggcagcaggc
agggaagtgacccgggcctcccgacccacggtcggctcctccggtcgcttcgtgagtcca
gagcagcacgcgtgcagctggcagctcttggtacccgccccggggacgccgactggcgga
gagctggccttgcgctgccagaccccgggcggggcgagtctgcattgcgcctaccgcggg
catccggagcgctgcgcggccaccggcgcccggcgcgcgcactactggagacggctgctg
ggcgcgctgcgcaggagaccacggccctgcctggaccccgcgccgctgccgccacgcctg
tgcgcccgcaagacggctggctcagacctgcactcgcccgctcaccccagcctacccgcg
cgtcccagcgagccgccccggtccagggcgcggagcccggctcggtcgcgacagtcggtg
cggtccccaagctcccagccggaaaagaagcccttgctagtgaagtccaactcgggcggg
aggaaagcgggctcagacccagttccggagcctcctgcggcggccggattccaacccaat
gggctggaccagaatgccgagctcactgagacctactgcaccgagaagtggcattccctt
tgcaacttctttgtcaacttctggaatggctga

DBGET integrated database retrieval system