KEGG   Mus musculus (mouse): 72535
Entry
72535             CDS       T01002                                 

Gene name
Aldh1b1, 2700007F14Rik
Definition
(RefSeq) aldehyde dehydrogenase 1 family, member B1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00053  Ascorbate and aldarate metabolism
mmu00071  Fatty acid degradation
mmu00280  Valine, leucine and isoleucine degradation
mmu00310  Lysine degradation
mmu00330  Arginine and proline metabolism
mmu00340  Histidine metabolism
mmu00380  Tryptophan metabolism
mmu00410  beta-Alanine metabolism
mmu00561  Glycerolipid metabolism
mmu00620  Pyruvate metabolism
mmu00770  Pantothenate and CoA biosynthesis
mmu01100  Metabolic pathways
mmu01240  Biosynthesis of cofactors
Module
mmu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    72535 (Aldh1b1)
   00053 Ascorbate and aldarate metabolism
    72535 (Aldh1b1)
   00620 Pyruvate metabolism
    72535 (Aldh1b1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    72535 (Aldh1b1)
   00561 Glycerolipid metabolism
    72535 (Aldh1b1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    72535 (Aldh1b1)
   00310 Lysine degradation
    72535 (Aldh1b1)
   00330 Arginine and proline metabolism
    72535 (Aldh1b1)
   00340 Histidine metabolism
    72535 (Aldh1b1)
   00380 Tryptophan metabolism
    72535 (Aldh1b1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    72535 (Aldh1b1)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    72535 (Aldh1b1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     72535 (Aldh1b1)
SSDB
Motif
Pfam: Aldedh RHH_6
Other DBs
NCBI-GeneID: 72535
NCBI-ProteinID: NP_082546
MGI: 1919785
Ensembl: ENSMUSG00000035561
Vega: OTTMUSG00000006730
UniProt: Q9CZS1
Position
4; 4 B1
AA seq 519 aa
MLTARLLLPRLLCLQGRTTSYSTAAALPNPIPNPEICYNKLFINNEWHDAVSKKTFPTVN
PTTGEVIGHVAEGDRADVDLAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVY
LASLETLDNGKPFQESYVLDLDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVGV
CGQIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNII
TGYGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGESNLKRVTLELGGKSPSIVLADA
DMEHAVDQCHEALFFNMGQCCCAGSRTFVEESIYREFLERTVEKAKQRKVGNPFELDTQQ
GPQVDKEQFERILGYIRLGQKEGAKLLCGGERLGERGFFIKPTVFGDVQDGMRIAKEEIF
GPVQPLFKFKKIEEVIQRANNTRYGLAAAVFTRDLDKAIYFTQALQAGTVWVNTYNIVTC
HTPFGGFKESGNGRELGEDGLRAYTEVKTVTIKVPEKNS
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgctgactgcccgactcttgctgccccggctcctctgcctccagggcaggactacctct
tactctacagcagctgctctcccgaacccaatcccaaacccagagatttgctacaacaag
ctgttcatcaacaacgagtggcatgatgcggtcagcaaaaagaccttccccacagtgaac
cccactacaggtgaggtcattgggcatgtggccgaaggtgaccgggcagatgtggatctg
gctgtaaaagcagcccgagaagccttccgcctggggtccccatggcgcaggatggatgcc
tcagagcggggccggctgctgaaccgcctagctgatcttgtggaacgagatcgagtgtac
ttggcctcactggagacgctagataacgggaaacctttccaggagtcttatgtcttggat
ctggatgaagtcatcaaggtgtaccgttacttcgctggctgggctgacaagtggcatggt
aagaccatccctatggatggtgagcatttctgcttcacccgacatgagccagtgggtgtc
tgtggccagataatcccttggaacttcccactggtcatgcagggctggaagctggccccg
gcactcgccacgggcaacactgtggtcatgaaggtggcagagcagaccccactctctgct
ctgtacttggcctccctcatcaaagaggcggggtttcccccaggagtggtgaacatcatc
actggctacggccccacggcgggagctgccatcgctcagcacatggatgtggataaagtc
gccttcacgggctccactgaggtaggccacctgattcagaaggcagctggcgagtctaac
ctcaagagagtcaccctggagctgggtgggaagagccccagcattgtgctggcagacgct
gacatggagcatgccgtagatcagtgtcacgaagcccttttcttcaacatgggccagtgc
tgctgtgcaggctcccggacattcgtggaagagtccatctaccgtgagtttctcgagaga
actgtggagaaggccaagcagaggaaagtggggaacccctttgagttggacacccagcag
ggacctcaggtggacaaggagcagtttgaacgaatcctgggctacatccggctgggacag
aaggaaggggcaaagcttctctgtggcggggagcgtttgggggagcgcggcttcttcatc
aaacccacagtcttcggggacgttcaggatggcatgaggatcgccaaggaggagatcttt
gggcccgtgcagcctctgttcaagttcaagaagatcgaggaagtaatccagagagccaac
aacaccaggtatggcctggctgcggctgtgttcacccgagacctggacaaggccatctac
ttcacgcaggccctgcaagctgggacggtgtgggtgaacacctataacattgtcacctgc
cacacgccattcggaggctttaaggaatctggcaatggcagggagctgggggaggacggg
ctcagagcctacacggaggtgaagactgtcaccatcaaggttcccgagaagaattcctga

DBGET integrated database retrieval system