KEGG   Mus musculus (mouse): 72544Help
Entry
72544             CDS       T01002                                 

Gene name
Exosc6, 2610510N21Rik, C76919, Mtr3
Definition
(RefSeq) exosome component 6
  KO
K12587  exosome complex component MTR3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03018  RNA degradation
Module
mmu_M00391  Exosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    72544 (Exosc6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    72544 (Exosc6)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     72544 (Exosc6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNase_PH
Motif
Other DBs
NCBI-GeneID: 72544
NCBI-ProteinID: NP_082550
MGI: 1919794
Ensembl: ENSMUSG00000109941
Vega: OTTMUSG00000060250
UniProt: Q8BTW3
Position
8; 8 E1
AA seq 273 aa AA seqDB search
MPGDHRRIRGPEESQPPQLYAAEDDETPAARDPTRLRPVYARAGLLSQAKGSAYLEAGGT
KVLCAVSGPRQAEGGERGSGPAGAGGEAPAALRGRLLCDFRRAPFSGRRRRAPQGGGGED
RELGLALQEALEPAVRLGRYPRAQLEVSALLLEDGGCALAAALTAAALALADAGVEMYDL
VVGCGLSLTPGPSPTWLLDPTRLEEEHSAAGLTVALMPVLNQVAGLLGSGEGGQTESWTD
AVRLGLEGCQRLYPVLQQCLVRAARRRGAAAPP
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgccgggagaccatcgccgcatccgcgggccggaggagtctcagccgccgcagctgtac
gcggccgaagacgacgagacgcccgctgctcgcgacccgacgcggctccgcccggtgtac
gcgcgcgccgggctgctgagccaggccaagggctccgcctacctggaggcgggcgggacc
aaggtgctgtgcgccgtgtccggtccgcggcaggccgagggcggcgagcgcggcagcggc
cctgcgggagcgggcggggaagctcccgctgccctccggggtcgcctgctctgcgatttc
cgccgcgctcccttctccggtcgccggcgtcgcgcgccccagggcggcggcggggaggat
cgcgagctgggactggcgctacaggaggctctggagcccgccgtgcgcctggggcgctac
ccgcgtgctcagctcgaggtgtcggcgctgctgctggaggacggcggctgtgcgctggcc
gcggcgctcaccgcggccgcgctcgccctggccgacgcgggagtggagatgtacgatctg
gtggtgggctgcggcctgagcctcaccccgggaccctccccgacctggctgctggacccc
acgcggctggaggaggagcactccgcggccggtctcacggtggccctcatgcctgtgctc
aatcaggtggccgggttactgggcagtggggaaggcgggcagactgagagttggaccgat
gctgtgcgcctgggcctggagggctgccagcgcctctacccagtgctgcagcagtgtttg
gtgcgggctgcccgccggaggggtgccgccgccccaccctga

DBGET integrated database retrieval system