KEGG   Mus musculus (mouse): 72560
Entry
72560             CDS       T01002                                 

Gene name
Naalad2, 2700022G20Rik, D9Ertd285, D9Ertd285e, Folh, Folh1b, GC, GCP, GCP3, GCPIII, NAA, NAADALASE2, NAALADASE2
Definition
(RefSeq) N-acetylated alpha-linked acidic dipeptidase 2
  KO
K01301  N-acetylated-alpha-linked acidic dipeptidase [EC:3.4.17.21]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    72560 (Naalad2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.21  glutamate carboxypeptidase II
     72560 (Naalad2)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   72560 (Naalad2)
Motif
Pfam: TFR_dimer Peptidase_M28 PA PPR_3
Other DBs
NCBI-GeneID: 72560
NCBI-ProteinID: NP_082555
MGI: 1919810
Ensembl: ENSMUSG00000043943
Vega: OTTMUSG00000036485
UniProt: Q9CZR2 Q3UZV6
Position
9 A2; 9 7.02 cM
AA seq 740 aa
MARPRHLRGLGMCITAVLASFIAGFTVGWFIKPLKETTTSAGYHQSIQQKLLSEMKAENI
RSFLRSFTKLPHLAGTEQNLLLAKKIQTQWKKFGLDSANLVHYDVLLSYPNETNANYVSI
VDEHGVEIFKTSYLEPPPDGYENVTNIIPPYNAFSASGMPEGELVYVNYARTEDFFKLER
EMNINCTGKIVIARYGKIFRGNKVKNAMLAGAMGIILYSDPADYFAPDVQPYPKGWNLPG
AAAQRGNVLNLNGAGDPLTPGYPAKEYTFRLPVEEAVGIPNIPVHPIGYNDAERLLRNLG
GAAPPDKSWKGSLNVSYNIGPGFTGSEYSRNIRMHVNNINKITRIYNVIGTIRGSTEPDR
YVILGGHRDSWVFGGIDPTTGTAVLQEIARSFGKLVNGGWRPRRTIIFASWDAEEFGLLG
STEWAEENAKLLQERSIAYINSDSAIEGNYTLRVDCTPLLNQLVYKVAREISSPDDGFES
KSLYESWLEKDPSPENKECPRINKLGSGSDFEAYFQRLGIASGRARYTKNKKTDKYSSYP
VYHTIYETFELVQNFYDPTFKKQLSVAQLRGALVYELADSVVIPFNIQDYAKALKNYAAS
IFNISKKHDQQLRNHAVSFDPLFSAVKNFSEAASDFHRRLTQVDLNNPIAVRIMNDQQML
LERAFIDPLGLPGRKFYRHIIFAPSSHNKYAGESFPGIYDAMFDIENKADPSLAWAEVKK
HISIAAFTIQAAAGTLTNVL
NT seq 2223 nt   +upstreamnt  +downstreamnt
atggcaaggcctaggcatctccgtggcttgggaatgtgcattaccgcggtgctggcctcc
ttcatcgctggctttactgtgggctggtttattaagcctctcaaagaaacaactacttct
gctggttatcatcaaagtatacaacagaaactcctatctgaaatgaaagctgaaaacatt
agatcatttcttcgttcctttacaaaacttccccatctggcaggaacggaacaaaattta
cttcttgccaagaaaatccaaacacagtggaagaaatttggattagattcagctaacctg
gttcattacgatgttctcttgtcttatccaaatgagaccaatgcaaactatgtatccatt
gtggatgagcatggagttgagatttttaaaacatcataccttgaaccaccaccagatgga
tatgagaatgttacaaacatcataccaccatacaatgcgttttcagccagcggcatgccg
gagggagagcttgtgtatgtcaactacgctcgtactgaggacttcttcaaactagaaaga
gaaatgaacatcaactgcactggcaagattgttatcgcaagatatgggaagatctttaga
ggaaacaaagtcaaaaatgccatgctagctggggccatgggaatcattctgtactctgat
ccagctgactactttgcccctgatgtgcagccatatcccaaaggatggaaccttcctgga
gctgcagctcagagaggaaatgtcttaaatctgaatggggcaggtgacccactcactcca
ggctatccagctaaagaatacaccttcagacttcctgttgaagaagcagtggggattcca
aacatacctgtacatcctattggatataatgatgcagagagactattacgcaacttggga
ggagctgctccaccagacaaaagctggaagggaagtctaaatgtcagttacaatattggg
cctggctttacaggaagtgaatattccaggaacattagaatgcatgttaataacattaac
aaaatcacaagaatttacaatgtaattggaactatcagagggtctacagaacctgacagg
tatgtcattctcggaggtcatcgtgactcctgggtgtttggagggattgaccctaccact
gggacagcagttttgcaagagattgcgcgaagttttgggaaacttgtgaatggaggttgg
agacctaggagaactatcatttttgccagctgggatgcagaggagtttgggctgctgggg
tcaactgaatgggctgaagagaatgcaaagctcctacaggagagaagcattgcttacatc
aactcagattctgctatagaaggtaattacactcttcgagttgattgtactcctcttcta
aaccagctggtttacaaagtggcaagagagatctccagtcctgatgatggttttgaaagt
aaatcactttatgaaagctggctggaaaaagacccttcacctgaaaataaagagtgtcct
agaatcaataagcttggatctgggagtgattttgaggcttacttccaaagacttggaatt
gcttcaggcagagctcgctacactaagaacaagaaaacagataaatacagtagctatcct
gtatatcataccatctatgagacgtttgaattagtacagaacttttatgaccccacattt
aaaaagcaactgtctgtggctcagttacgaggagcattggtatatgagcttgcagactct
gtggtcattcctttcaacattcaagactatgcaaaagccttgaaaaactatgcagcaagt
attttcaacatatccaagaaacacgaccagcaattgagaaaccatgcagtgtcatttgat
cccttattttctgctgtgaaaaacttttcggaggctgcttcagattttcacagaagactt
acacaagttgatcttaataatcctattgcagtgagaattatgaatgaccagcagatgctt
cttgaaagagcattcatagatcctcttggtttacctgggaggaagttctacaggcacatc
atctttgctccaagcagccacaacaaatatgccggagaatcattccctgggatttatgat
gccatgtttgatattgaaaataaggcagacccttccttggcctgggcagaagtgaagaaa
catatttctattgcagcttttacaattcaggcagcagcggggacactgaccaatgtgtta
tag

DBGET integrated database retrieval system