KEGG   Mus musculus (mouse): 72584
Entry
72584             CDS       T01002                                 

Gene name
Cul4b, 2700050M05Rik, AA409770, CUL-4B, mKIAA0695
Definition
(RefSeq) cullin 4B
  KO
K10609  cullin 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03420  Nucleotide excision repair
mmu04120  Ubiquitin mediated proteolysis
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    72584 (Cul4b)
  09124 Replication and repair
   03420 Nucleotide excision repair
    72584 (Cul4b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    72584 (Cul4b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    72584 (Cul4b)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    72584 (Cul4b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    72584 (Cul4b)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Cullin
     72584 (Cul4b)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      72584 (Cul4b)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      72584 (Cul4b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   72584 (Cul4b)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 SecA_SW
Other DBs
NCBI-GeneID: 72584
NCBI-ProteinID: NP_001103612
MGI: 1919834
Ensembl: ENSMUSG00000031095
Vega: OTTMUSG00000017236
UniProt: A2A432 Q3TP81
Position
X; X A3.3
AA seq 970 aa
MSRSTRSKERRENDTDSEDNSSETSNQERRRCRQGPPRPPYPPLLPPVFPPPTPPPQVRR
TRGLQDLGAMKSVCPGTSGFSSPNPSAASAAAQEVRSATDGNTSTTPPTSAKKRKLNSSS
SSSNSSNEREDFDSTSSSSTPPQPRDSASPSTSSFCLGVPVATSSHVPIQKKLRFEDTLE
FVGIDTKMAEESSSSSSSSSPTAATSQQQQQQQLKTKSILISSVASVHHANGLAKSSTAV
SSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQA
VENLCSHKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMI
RSIFLFLDRTYVLQNSMLPSIWDMGLELFRAHIISDQKVQTKTIDGILLLIERERNGEAI
DRSLLRSLLSMLSDLQIYQDSFEQQFLQETNRLYAAEGQKLMQEREVPEYLHHVNKRLEE
EADRLITYLDQTTQKSLIASVEKQLLGEHLTAILQKGLNSLLDENRIQDLSLLYQLFSRV
RGGVQVLLQQWIEYIKAFGSTIVINPEKDKTMVQELLDFKDKVDHIIDTCFLKNEKFINA
MKEAFETFINKRPNKPAELIAKYVDSKLRAGNKEATDEELEKMLDKIMIIFRFIYGKDVF
EAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMIQFK
QYMQNQNVPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRKLQW
QSTLGHCVLKAEFKEGKKELQVSLFQTMVLLMFNEGEEFSLEEIKHATGIEDGELRRTLQ
SLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTERVF
QDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYMERDK
ENPNQYNYIA
NT seq 2913 nt   +upstreamnt  +downstreamnt
atgtcacgttcaactaggtctaaagaaagaagagagaatgacaccgactcagaagataac
agttcggaaacctccaatcaagagcgccgaaggtgtcgccaaggtccgccccgccctccc
tatccacctcttttaccccccgtgttccctcccccaacccccccacctcaagtccggcgg
acccgggggcttcaggatctgggagctatgaaaagtgtctgcccaggcacttccggtttt
tcttcccccaatccctctgctgcttctgctgctgctcaggaggtcagatctgccactgat
ggtaataccagcaccactccgcccacctctgccaagaagagaaagttaaacagcagcagt
agcagcagtaacagtagtaacgagagagaagactttgattccacctcttcctcttccacc
cctccacaacccagagattcggcgtccccttcaacctcgtccttctgccttggggttcca
gtggccacttccagccacgtacctatacagaagaagctgcggtttgaagacaccctggag
tttgtagggattgatacgaaaatggctgaggaatcttcctcctcatcttcctcatcttcg
ccaactgctgcaacctcacagcagcagcagcagcaacaacttaaaactaagagtatatta
atttcttctgtggcttcagtgcaccatgcaaacggcctggctaaatcttctaccgcggtc
tctagctttgctaacagcaagcccggctcagctaagaagttagtgatcaagaactttaaa
gataagcctaaattaccagaaaactatacggatgagacatggcaaaagctaaaagaagca
gtggaagccattcagaatagtacttcaattaagtacaatttagaagaactctaccaggct
gtagaaaatctttgttctcataagatttctgcaaatttgtataagcagctgaggcagata
tgtgaagatcacatcaaagcacagattcatcagttcagagaggattcattggatagtgtt
ctttttctcaaaaagatcgatagatgctggcaaaaccactgtaggcaaatgataatgatc
aggagcatttttttgtttctggatagaacttatgttcttcagaattcaatgctaccctcc
atttgggacatgggattagagttatttagggctcatattataagtgatcaaaaagtacag
acaaaaacgattgatggcatccttctcttgattgagagagagcggaatggtgaagcaatt
gatagaagtttacttcgaagccttttaagtatgctgtctgatttgcaaatttaccaagat
tcttttgaacagcaatttttgcaagaaactaatcggctttacgcagccgaaggtcagaag
ttaatgcaagaaagagaggttcctgagtatcttcatcatgttaataaacgcctagaagaa
gaagctgacagacttattacttacttagatcagaccacccagaagtcactaattgcttct
gttgaaaaacaacttctaggtgaacacttaacggcaattcttcaaaaaggtttaaatagc
ctccttgatgaaaaccgaattcaagatttgtctctcctgtatcagctcttcagtagagtt
cggggtggagttcaggttctcttacagcagtggattgagtatatcaaggcttttggaagt
accattgttattaatcctgaaaaagataaaactatggttcaagaattattggactttaaa
gataaagttgaccatataattgatacctgctttctgaaaaatgaaaaatttatcaatgcc
atgaaagaagcttttgaaacattcattaataaaagaccaaataagccagctgaactgata
gctaagtatgtggattcaaaacttcgtgcaggcaacaaagaagctacagatgaagagctt
gagaaaatgttggataaaataatgattatatttagatttatctatggtaaagatgttttt
gaggccttctataagaaagatttagccaaacgcctattagttggcaagagtgcatcagta
gatgctgaaaaatcaatgctgtccaaactgaaacacgaatgtggagccgcttttaccagc
aagcttgaaggaatgttcaaagacatggagctttctaaagatatcatgattcagtttaaa
cagtatatgcagaaccagaatgtacctggcaatattgaattaactgttaatatcctgaca
atgggttactggccaacatatgtgcctatggaagtccatttgccgccagagatggtaaag
cttcaggaaattttcaagacattttacttaggcaagcacagtggcaggaaactccagtgg
cagtcaaccttgggacactgtgtgctaaaagctgaatttaaagagggcaaaaaagaactt
caggtctctctttttcaaaccatggtgctgctaatgtttaatgaaggagaagaattcagt
ttagaagagatcaagcatgctactgggatagaggatggagaattaagaagaacactgcag
tcactagcctgtggcaaagctagagttctggctaaaaatcctaagggcaaagatattgaa
gatggtgacaaatttatttgtaatgacgatttcaaacacaaactattcaggataaagatc
aatcaaatccagatgaaagaaacggttgaagaacaagcaagcactacagaaagagtattt
caagacagacagtaccaaattgatgctgcgatcgttcgaattatgaagatgagaaaaaca
cttagccacaatcttcttgtttcagaagtctacaatcagctaaaatttccagttaaacct
gctgatcttaagaagagaatagaatccctcattgaccgggactacatggaaagagataaa
gaaaatccaaatcagtacaactatattgcatag

DBGET integrated database retrieval system