KEGG   Mus musculus (house mouse): 72587
Entry
72587             CDS       T01002                                 
Symbol
Pan3, 2700050F09Rik, A430027N15Rik
Name
(RefSeq) PAN3 poly(A) specific ribonuclease subunit
  KO
K12572  PAB-dependent poly(A)-specific ribonuclease subunit 3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    72587 (Pan3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    72587 (Pan3)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     72587 (Pan3)
  mRNA degradation factors
   3'-5' decay
    Pan complex
     72587 (Pan3)
SSDB
Motif
Pfam: Pan3_PK zf-CCCH Pkinase zf_CCCH_4 zf-CCCH_4 Torus zf-CCCH_2
Other DBs
NCBI-GeneID: 72587
NCBI-ProteinID: NP_082567
MGI: 1919837
Ensembl: ENSMUSG00000029647
UniProt: Q640Q5
Position
5:147363018..147485311
AA seq 837 aa
MNSGGGGGLPPPSAAASPSSSSLAAAVAVAVAASSGVGGVPGGPAAAAGVKLKYCRYYAK
DKTCFYGEECQFLHEDPAAGAAPGLGLHSNSVPLALAAAAGAAFPPGALPGGGAGPPAGP
KKPELGVPGAATAGGGLDGPRVAIPGMDGGALTDASLTESYFSTSFIGVNGFGSPVETKY
PLMQRMTSSSSSPSLLNDSAKPYTGHDLLTSSASSLFNDFGALNISQRRKTPNPTASEFI
PKGGSTSRLSNVSQSNMSAFSQVFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTS
PAPRRRSHTPNPASFMVPPSASTPANNPAPQPPSSGQVIQKETVGGTTYFYTDTTPAPLT
GMVFPNYHIYPPTAPHVAYMQPKANAPSFFMADELRQELINRHLITMAQIDQADMPAVPT
EVDSYHSLFPLEPLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHGFRLVNTKCM
VLVDMWKKIQHSNIVTLREVFTTKAFAEPSLVFAYDFHAGGETMMSRHFNDPNSDAYFTK
RKWGQHDGPLPRQHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITSKTRL
RVNCVGVFDVLTFDNSQNNNPLALMAQYQQADLISLGKVVLALACNSLAGIQRENLQKAM
ELVTINYSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKE
VQNGRLFRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSH
IISCLNKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGNDRNSN
NT seq 2514 nt   +upstreamnt  +downstreamnt
atgaacagtggcggcggcggtggcctcccgccgccctcggccgctgcctcgccgtcgtcg
tcctcgctggcggcggccgtggcggtggcggtggcggcctcgtcgggcgtcgggggcgtc
cccggcgggccggcggcggcggcgggcgtgaagctcaagtactgccgctactacgccaag
gacaagacgtgcttctacggcgaggagtgtcagttcctgcacgaggacccagccgccggc
gcggccccggggcttggcctccatagcaacagcgtcccgctggcgctagcggccgcggcc
ggggccgcctttcctccgggagcgctcccgggcgggggagcggggccgcccgcggggccc
aagaagccggagctgggcgtcccgggggcggcgaccgcgggcggcggactcgatggcccg
cgggtggcgattccgggaatggatggaggtgctttaactgatgcgagtctcacagagtcc
tatttcagcaccagctttattggagtcaatggatttggaagccctgtagaaacaaagtat
cccttgatgcagagaatgactagtagtagcagctccccaagccttctaaatgacagtgcc
aagccatacacaggccacgatcttctgacttcatctgcttcatccttgtttaatgacttc
ggtgccctcaacatctcccagagaaggaagacaccaaatcctactgcaagcgaatttata
cctaaaggaggatcaacctccaggctgagtaacgtgtcccagtcaaatatgtctgccttc
tctcaagttttctctcacccatccatgggaagtcctgctactgctggattagcaccagga
atgtcactgtctgctggatcttcccctctccattcccccaaaattactccacacacctct
cctgctcctagaagaagaagccacactccaaacccagcaagtttcatggtgccgcctagt
gcctccactcctgccaataaccctgctcctcagcctccgtcctctggtcaggtgatccag
aaggagactgtcggggggacgacttacttctatacagatacaaccccagcacctttgact
ggaatggtatttccaaactatcatatttatcctccaaccgcacctcatgttgcttatatg
caaccaaaagcaaatgcaccttccttcttcatggccgacgagctccgacaggagctgatc
aacagacatttaataacgatggctcaaattgaccaagcagatatgccagcagtccccaca
gaagttgacagctaccatagcctgttccctctagaaccactgccacctcccaaccggata
cagaaatcaagtaattttggatatatcacgtcttgctacaaagctgtaaatagcaaagat
gatctgccatattgccttcggaggatacatggttttcgtcttgttaacacaaagtgcatg
gtgttggttgatatgtggaaaaaaattcagcactcaaatattgtaactctgcgtgaagtg
tttaccactaaagcatttgccgagccttctctggtgttcgcctatgatttccatgctgga
ggagaaactatgatgagcagacactttaacgacccgaattctgatgcctacttcacaaag
aggaagtggggccagcacgatggaccactgcccaggcagcatgctggattgttaccagag
tctctcatctgggcatacattgtacagctgagttctgctctgcggaccattcatacagca
ggtttggcctgtagagtaatggacccaacgaagattctgataaccagcaaaacaaggtta
cgagtaaattgtgtaggagtctttgatgttttaacatttgataacagtcaaaataataat
cctttggcattaatggctcagtaccagcaagcagatctgatatcattaggaaaagttgtg
ttggctttggcttgcaactctttggcaggaattcagcgagaaaatttacagaaagccatg
gaattggtgacaatcaactactcctctgacctgaagaacctcatcttgtacttgttgact
gaccaaaacaggatgcggagtgtgaatgacatcatgcccatgattggtgctcggttttac
actcaattggatgctgctcaaatgagaaatgatgttatcgaggaagaccttgctaaggag
gttcaaaatggaagactgtttaggcttctagcaaaattgggaacaatcaacgagaggccg
gagtttcagaaggatccaacctggtcagagactggagacagatacctgttgaaactcttt
agagatcatctttttcatcaggtgacagaagcaggtgctccctggatcgacctcagtcac
atcatttcttgtcttaacaagctagatgctggtgtgccagaaaaaatcagcctgatttcc
agagacgagaagagcgtgctggtggtgacatacagtgacctaaaacgctgctttgaaaat
acctttcaagaactgattgcggctgcaaatggtaacgatcggaacagtaactga

DBGET integrated database retrieval system