KEGG   Mus musculus (house mouse): 72621
Entry
72621             CDS       T01002                                 
Symbol
Pdzd11, 1810012H22Rik, 2310079D11Rik, 2700099C19Rik, Pdzk11
Name
(RefSeq) PDZ domain containing 11
  KO
K24061  PDZ domain-containing protein 11
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    72621 (Pdzd11)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 PDZ domain-containing proteins
  Other PDZ domain-containing proteins
   72621 (Pdzd11)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 Peptidase_M50 DUF4537 Baculo_p26
Other DBs
NCBI-GeneID: 72621
NCBI-ProteinID: NP_082579
MGI: 1919871
Ensembl: ENSMUSG00000015668
UniProt: Q9CZG9
Structure
Position
X:complement(99665949..99673667)
AA seq 140 aa
MDNRIPYDDYPVVFLPAYENPPAWIPPHERVYHPDYNNELTQFLPRIVTLKKPPGAQLGF
NIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREI
SMRVRFFPYNYHRQKERTVH
NT seq 423 nt   +upstreamnt  +downstreamnt
atggacaaccggattccctatgatgactaccctgtggttttcctgccggcctatgaaaac
cctccagcgtggattcctcctcatgagagagtgtaccacccagactacaacaatgagttg
acccagtttctgccccgaattgttacactgaagaagcctcctggtgctcagttgggattt
aacatccgaggaggaaaggcctcgcagctaggcatcttcatctccaaggtgattccagac
tcggatgcacatcgagcaggacttcaagaaggggaccaagttctagctgtgaatgatgtg
gatttccaagatattgagcacagcaaagctgtggaaatcctgaagacagcccgagaaatc
agcatgcgtgtgcgcttctttccctacaattatcatcgccaaaaggaacggactgtgcac
tag

DBGET integrated database retrieval system