KEGG   Mus musculus (house mouse): 72630
Entry
72630             CDS       T01002                                 
Symbol
Hspa12b, 2700081N06Rik
Name
(RefSeq) heat shock protein 12B
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: HSP70
Other DBs
NCBI-GeneID: 72630
NCBI-ProteinID: NP_082582
MGI: 1919880
Ensembl: ENSMUSG00000074793
Vega: OTTMUSG00000015727
UniProt: Q9CZJ2
Position
2:130969332..130987905
AA seq 685 aa
MLTVPEMGLQGLYISSSPERSPVPSPPGSPRTQESCGIAPLTPSQSPKPEARALQQASFS
VVVAIDFGTTSSGYAFSFASDPEAIHMMRKWEGGDPGVAHQKTPTCLLLTPEGIFHSFGY
TARDYYHDLDPEEARDWLYFEKFKMKIHSATDLTLKTQLEAVNGKKMLALEVFAHALRFF
KEHALQELREQSECMLEKGAVRWVLTVPAIWKQPAKQFMREAAYLAGLVSREDAEKLLIA
LEPEAASVYCRKLRLHQLMDLSSRTAGRGRLGERRSIDSSFRHAREQLRRSRHSRTFLVE
AGVGELWAEMQEGDRYMVADCGGGTVDLTVHQLEQPHGTLKELYKASGGPYGAVGVDLAF
EQLLCRIFGEDFIAKFKRQRPAAWVDLTIAFEARKRTAGPHRAGALNISLPFSFIDFYRK
QRGHNVETALRRSSVNLVKWSSQGMLRMSCEAMNELFQPTVSGIIQHIEMLLAKPEVQGV
KLLFLVGGFAESAVLQHAVQEALGTRGLRVVVPHDVGLTILKGAVLFGQAPGVVRVRRSP
LTYGVGVLNRFVPGHHPPEKLLVRDGRRWCTDVFERFVAAEQSVALGEEVRRSYCPARPG
QRRVLINLYCCAAEDARFITDPGVRKCGALSLELEPEGCPENTGTSPSRREIRAAMQFGD
TEIKVTAVDVSTNRSVRAAIDFLSN
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgctgactgtcccggaaatgggcctgcaagggctgtatatcagctctagcccagagagg
tccccggtgcccagccctcccggctccccgaggacccaggaaagctgtggtatcgctccc
ctcacgccttcacagtctccaaagccagaggcccgagctctacagcaggcttccttctct
gtggttgtggccatcgactttggaaccacatccagtggctatgccttcagctttgctagt
gaccctgaggccattcacatgatgaggaaatgggagggaggggacccaggcgtggcccac
cagaagacccccacttgcctgctgctgaccccagaaggcatctttcacagttttggctac
actgcccgtgactactaccacgacctagaccctgaggaggctcgggactggctctacttt
gagaagtttaagatgaagattcacagtgccactgatctcaccttgaagacccagctcgag
gcggtaaatgggaagaagatgctggctctggaagtgtttgcccatgccctccgtttcttc
aaggagcacgcccttcaggagctgagagagcagagcgagtgtatgcttgagaagggtgct
gtgcgctgggtgctgacagtacctgccatctggaaacaaccggctaaacagttcatgaga
gaggccgcctacctggctggcttggtgtctcgagaggatgcagagaaactcctcattgcc
ctggagcctgaggctgcctctgtctactgtcggaaacttcgcctgcaccagctcatggac
ctgagtagccggactgcaggccgtgggcgcctgggtgagcggaggtctatcgactccagc
tttcgacatgcccgggagcagctgcgtaggtctcgccacagccgaactttcctggtggag
gccggtgtgggagagctgtgggcagagatgcaagaaggagaccgctacatggtggccgac
tgcgggggtggcactgtggacctgacggtacaccagttggagcagcctcacgggaccctc
aaggagctctacaaggcttctggcggtccctatggagcagtaggcgtggacttggccttt
gagcagctgctctgccgcatattcggggaggacttcattgccaaattcaaaaggcaacgg
ccagcagcttgggtggatctaaccattgccttcgaggcccgcaaacgcacggcaggcccg
caccgtgcgggggcgctcaacatttcgcttcctttctctttcattgacttctaccgcaag
caacgagggcacaatgtggagaccgccctgcgcaggagcagtgtgaacctcgtgaagtgg
tcctcacaggggatgctccggatgtcctgtgaggctatgaatgagctgtttcaacccacg
gtcagtgggatcatccaacacatagagatgctgctggctaagcctgaggtgcagggtgtg
aagttgctattcctggtgggcggctttgcggagtcggcggtgctgcagcacgcggtgcag
gaagccctgggcactcgtggcctgcgcgttgtggtcccgcatgacgtgggcctcaccatc
ctcaagggagcagtgctcttcggccaggcacccggtgtggtgcgagtgcgccgctccccc
ctcacttatggtgtgggcgtgctcaatcgttttgtgcctggccaccacccacccgagaaa
ttgctggttcgggatgggcgccgctggtgcacggatgtctttgagcgcttcgtagcagca
gagcagtcggtggccctaggagaggaggtaaggcgcagctactgtcctgcgcgcccgggc
cagcggcgtgtgctcatcaatctgtactgctgcgctgcggaggatgcgcgcttcatcact
gaccctggtgtgcgcaagtgtggtgcactcagcctggagcttgagcctgaaggctgcccg
gaaaacacaggcacatcccccagccgccgtgagatccgtgctgccatgcagtttggcgat
actgagattaaggtcactgccgtggatgtcagcaccaatcgctctgtgcgggcagccatc
gactttctttccaactga

DBGET integrated database retrieval system