KEGG   Mus musculus (mouse): 72656
Entry
72656             CDS       T01002                                 

Gene name
Ints8, 2810013E07Rik, AV063769, D130008D20Rik
Definition
(RefSeq) integrator complex subunit 8
  KO
K13145  integrator complex subunit 8
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    72656 (Ints8)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   Integrator complex
    72656 (Ints8)
SSDB
Motif
Pfam: Cas_Csx8
Other DBs
NCBI-GeneID: 72656
NCBI-ProteinID: NP_001153067
MGI: 1919906
Ensembl: ENSMUSG00000040738
Vega: OTTMUSG00000004593
UniProt: Q80V86
Position
4; 4 A1
AA seq 995 aa
MSAEAADREAATSSRPCTPPQTCWFEFLLEESLLEKHLRKACPDPAPVQLIVQFLEQASK
PSVNEQNQVQPPPDNKRNRVLKLLALKVAAHLKWDLDILEKSLSVPVLNMLLNELLCISK
VPPGTKHVDMDLSALPPTTAMAILLYNRWAIRTIVQSSFPVKQAKPGPPQLNVMNQMQQE
KELTENILKVLKEQAADCILVLEAALRLNKDLYVHTMRTLDLLAVEPGTVNGETENSTAG
LKIRTEEMQCQVCYDLGAAYFQQGSTDSAIYENAREKFFRTKELLAEIGSLSLHCTIDEK
RLAGYCQACDVLVPSSDNNSQQLTPYSQVHICLRSGSYQEVVQIFIEDNLTFTLPVQFRQ
SVLRELFQKAQQGNEALDEICFKICVCNTVRDVLEGRTISVQFNQLFLRPNKEKIDFLLE
VCSRSINVEKASDSLKGNMAAFLKNVCLGLEDLQYVFMISSHELFITLLKDEERKLLVDQ
MRKRSPRVNLCIKPVTSFYDIPASASVNIGQLEHQLILSVDPWRIRQILIELHGMTSERQ
FWTVSNKWEVPSVYSSVILGIKDNLTRDLVYILMAKGLHCSTVKDFPHSKQLFTACLELV
TEFSPKLRQVMLNEMLLLDIRTHEAGVGQSGERPPSDLISRVRGYLEMRLPDIPLRQVVA
EECVAFMLNWRENEYLTLQVPAFLFQNNPYVKLGQLLAATCKELPGPKESRRTAKDLWEV
VVQICSVSNQHKRGNDGRVSLIKQRESTLGIMYRSELLSFIKKLREPLVLTIILSLFVKL
HNVREDIVNDITAEHISIWPSSIPNLQSVDFEAVAITVKELVRYTLSINPNNHAWLIIQA
DIYFATNQHSAALHYYLQAGAVCSDFFNKAVPPDVYTDQVIKRMIKCCSLLNCHTQVAIL
CQFLREIDYKTAFKSLQEQNSHDAMDSYYDYIWDVTILEYLTYLHHKRGETDKRQIAIKA
IGQTELNASNPEEVLQLAAQRRKKKFLQAMAKLYF
NT seq 2988 nt   +upstreamnt  +downstreamnt
atgagcgcggaggcggcggaccgggaggcggccacctccagccggccctgcaccccgccg
cagacttgctggttcgagttcctgctggaggagtcgctgttggagaagcatctgcgcaaa
gcctgtccggatcctgcaccagttcagcttatagttcagtttttggagcaggcttccaaa
ccttcagttaatgagcaaaaccaagtccagcctccacctgataacaagagaaatcgcgtc
ctaaagcttcttgctcttaaagttgctgcacatttgaagtgggatttagacatactggag
aaaagcctgtctgttccggtgctgaacatgctgctgaatgagctcctgtgcatcagtaag
gtccctcccgggaccaagcacgtggacatggatctgtcagccctgcccccaaccactgcc
atggccatcctgctctacaaccgatgggcaattaggacaattgttcaaagtagttttcct
gtcaaacaggctaaacctggaccccctcaactaaatgtcatgaatcagatgcaacaggaa
aaagaactgacagaaaacattttgaaagtgctaaaagaacaagctgctgattgtattttg
gtcctggaagcagctctgagattaaacaaggatctgtatgttcacacgatgagaactcta
gacttgctggccgtggagccaggcacggtgaatggggagactgagaactctacggctggg
ttgaaaatcagaactgaggagatgcagtgccaggtgtgttatgacttgggtgcagcatac
ttccagcaaggctccacagattcagccatctatgaaaacgcaagagagaagttttttaga
actaaagaactacttgcagagataggttcattatctcttcattgtaccatagatgagaag
cggttagctggctattgtcaagcgtgtgatgttcttgtaccttcttctgataataactct
caacaattgactccatacagtcaagtccatatttgtttacgatctggcagctatcaggaa
gtagtgcagattttcattgaagataacttaactttcactttaccagtccagttccgacaa
tcggtattaagggaactttttcagaaagctcaacagggaaatgaagctctagatgaaatc
tgttttaaaatttgtgtctgcaacacagtacgagatgtactggaaggcagaacaattagt
gtccagttcaatcaactatttcttagaccaaacaaagaaaaaatagattttctccttgag
gtatgttcaagatcaataaacgtagaaaaagcttcagattctctgaaaggaaacatggct
gcttttctaaagaatgtgtgtctggggttggaagatctgcagtatgtcttcatgatttcg
tctcatgagcttttcattacactgttgaaagatgaagaacgaaagctgcttgttgatcaa
atgagaaagagatccccgagagtaaatctgtgcattaaacctgtgacttcattttatgat
atcccagcctcagcaagtgtcaacattggccagttggaacatcagcttatattatcagtg
gatccctggcggattagacagattttaattgaattgcatggtatgacttcagagcgacaa
ttttggactgtgtcaaataagtgggaagtaccttctgtatatagtagtgttatcctagga
attaaggacaatttaacaagagatttggtttacattctcatggccaaaggtttacactgc
agtactgttaaggactttcctcactccaaacagctctttacagcttgtttggagctggtg
acagagttctcaccaaaactccgccaggttatgctgaatgagatgctgcttttagatatt
cgcactcacgaggctggagtggggcagtcaggagagagacctccttctgaccttatcagt
agggtacgaggatatttggaaatgaggcttcctgatattccccttcgtcaagttgtagct
gaagagtgtgttgcttttatgctaaactggagagaaaatgaatatcttactctgcaagtt
cctgcatttttatttcagaataacccatatgtaaagcttggacagcttttagcagccacc
tgcaaagaacttccaggccctaaagagagtagacggaccgctaaagacctctgggaagtt
gttgttcagatctgcagtgtgtctaaccagcacaaacgaggaaatgatggcagagttagt
ttgataaagcagagggaatccacattaggcataatgtatcggagtgaactactttctttt
atcaaaaaactccgggaaccactggttttgactattattttatcactctttgtgaagctt
cacaatgttcgggaggacattgtgaatgatatcacagccgagcacatttctatctggcca
tcttccatacctaacctccaatccgtggattttgaagctgtagcaatcactgtgaaagag
ctagttcgatatacactcagtataaatccaaacaaccatgcttggctaattattcaagcg
gatatttattttgcaacaaatcagcattcggcagctcttcactattacctccaggcagga
gctgtgtgctctgacttctttaataaggctgtgcctcctgatgtatatacagaccaagtg
ataaaacgaatgataaaatgctgttctttgctgaattgtcatacacaggtggcaatttta
tgtcagttcctcagagaaattgactacaaaacagccttcaagtcattgcaggaacaaaac
agccatgacgctatggattcctactatgactacatttgggacgtcacaatcttggagtac
ttgacttatcttcatcataaaagaggagaaacagataaaagacagattgcaatcaaagcc
attggccaaacagaattgaatgcaagcaaccctgaagaagtattacagctggcagcacag
agaaggaaaaagaagtttctacaagcaatggcaaaactttacttttaa

DBGET integrated database retrieval system