KEGG   Mus musculus (house mouse): 72662
Entry
72662             CDS       T01002                                 
Symbol
Dis3, 2810028N01Rik
Name
(RefSeq) DIS3 homolog, exosome endoribonuclease and 3'-5' exoribonuclease
  KO
K12585  exosome complex exonuclease DIS3/RRP44 [EC:3.1.13.-]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    72662 (Dis3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    72662 (Dis3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-
     72662 (Dis3)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Exosome cofactors
     72662 (Dis3)
SSDB
Motif
Pfam: RNB OB_Dis3 PIN_4 Rrp44_CSD1 Rrp44_S1 CSD2 Toxin_R_bind_C
Other DBs
NCBI-GeneID: 72662
NCBI-ProteinID: NP_082591
MGI: 1919912
Ensembl: ENSMUSG00000033166
UniProt: Q9CSH3
Position
14:complement(99314070..99337217)
AA seq 958 aa
MLRSKTFLKKTRAGGVVKIVREHYLRDDIGCGAPACSACGGAHAGPALELQPRDQASSLC
PWPHYLLPDTNVLLHQIDVLEHPAIRNVIVLQTVMQEVRNRSAPIYKRIRDVTNNQEKHF
YTFTNEHHKETYIEQEQGENANDRNDRAIRVAAKWYNEHLKRVAADSQLQVILITNDRKN
KEKAVQEGIPAFTCEEYVKSLTANPELIDRLAYLSDEMNEIESGKIIFSEHLPLSKLQQG
IKSGSYLQGTFRASRENYLEATVWIHGDKEEEKEILIQGIKHLNRAVHEDIVAVELLPRS
QWVAPSSVVLDDEGQNEDDVEKDEERELLLKTAVSEKMLRPTGRVVGIIKRNWRPYCGML
SKSDIKESRRHLFTPADKRIPRIRIETRQASALEGRRIIVAIDGWPRNSRYPNGHFVKNL
GDVGEKETETEVLLLEHDVPHQPFSQAVLSFLPRMPWSITEEDMKNREDLRHLCVCSVDP
PGCTDIDDALHCRELSNGNLEVGVHIADVSHFIRPGNALDQESARRGTTVYLCEKRIDMV
PELLSSNLCSLRSNVDRLAFSCIWEMNHNAEILKTRFTKSVINSKASLTYAEAQMRIDSA
AMNDDITTSLRGLNQLAKILKKGRIEKGALTLSSPEIRFHMDSETHDPIDLQTKELRETN
SMVEEFMLLANISVAKKIHEEFSEHALLRKHPAPPPSNYDILVKAAKSKNLQIKTDTAKS
LADSLDRAESPDFPYLNTLLRILATRCMMQAVYFCSGMDNDFHHYGLASPIYTHFTSPIR
RYADIIVHRLLAVAIGADCTYPELTDKHKLSDICKNLNFRHKMAQYAQRASVAFHTQLFF
KSKGIVSEEAYILFVRKNAIVVLIPKYGLEGTVFFEEKDKPKPRLAYDDEIPSLRIEGTV
FHVFDKVKVKITLDSSNLQHQKIRMALVEPQIPGINIPPNVADKALTAPGGKKRKLEK
NT seq 2877 nt   +upstreamnt  +downstreamnt
atgctcaggtccaagacgttcttgaagaagacccgcgcgggcggcgtggtgaagatcgtg
cgcgagcactacctgcgggatgacatcggctgcggcgcgccggcttgctcggcctgcggc
ggggcgcacgcgggcccggccctggagctgcagccccgggaccaggcgagcagcctctgc
ccgtggccgcactaccttctgccggacaccaatgtgctgctgcaccagattgatgtcctc
gaacacccggccatcagaaatgtcattgtgctacaaacagtgatgcaagaagtgagaaac
cggagcgcccccatctacaagcgaatcagggatgtgaccaataaccaggaaaagcatttc
tataccttcactaatgagcaccataaagaaacctacatcgagcaagagcagggagagaat
gccaatgacaggaatgacagagccatccgagtcgcagcgaagtggtacaacgagcacctg
aagagggtggcagcagacagtcagctgcaagttatcctgataaccaatgacaggaagaac
aaagagaaagctgtgcaagaggggataccagccttcacgtgtgaagaatacgtaaagagc
ctgactgctaaccctgaacttatagaccgtcttgcttacttgtccgatgaaatgaatgaa
atagaaagtgggaaaataatattttcagagcatcttcccttaagcaagctccaacaaggc
ataaaatctggttcctatcttcaaggaacattcagagctagcagggaaaattatttggag
gctacagtatggattcatggagacaaagaagaggaaaaagagatacttatacagggaatt
aagcatctaaacagagctgtgcatgaagacattgtggccgtggagctactgcccaggagc
cagtgggtggcaccgtcttccgtggttttagacgatgaaggtcaaaatgaagacgatgtg
gagaaagatgaggagagagaactcctgcttaagactgctgtaagtgaaaaaatgttacgg
cctacaggtcgagttgtggggataataaaaaggaactggagaccgtattgtggcatgctt
tccaagtctgatattaaggagtcaagaagacatctctttacacccgctgataagagaatt
ccacgaattcggatagaaaccagacaggcttctgcgttagaaggacggagaattattgtc
gctattgatggttggcctagaaattctagatatccaaatggacactttgtaaagaattta
ggcgatgttggagagaaggagacagaaacggaagtgttgctgctcgagcacgatgttcct
catcagcccttttcccaggctgtgcttagcttcctgcccaggatgccctggagcattact
gaggaggacatgaaaaaccgagaagacctgagacatctgtgtgtttgcagtgtggaccct
ccagggtgcactgacatagatgacgctctgcattgtagagagctcagcaatggaaacttg
gaggttggtgttcatattgcggatgttagccattttatcaggccaggaaatgcgttggat
caagaatctgcaagaagaggaacaactgtttatctttgtgaaaagaggattgacatggtt
ccagagttgctcagctccaacctctgttccttaagatccaacgttgacaggttggcattt
tcctgtatttgggaaatgaatcataatgctgaaatattaaaaacgagatttaccaaaagt
gtcattaattcaaaggcttctcttacgtacgcggaagcacagatgagaattgattcggcg
gctatgaatgatgatattaccactagtctccgtggactcaatcagctggctaaaattcta
aaaaagggaaggattgaaaagggggctttgactctgtcttctccagagatccgattccac
atggacagtgaaacccacgacccaatcgacctgcagacgaaagagctgagagaaacaaat
tccatggtggaagaatttatgttacttgctaatatttctgtcgcaaaaaaaattcatgaa
gagttttctgaacatgctctgcttcggaaacacccagctccgcctccctcgaattatgac
attcttgttaaggctgcaaagtccaagaatttgcaaattaagactgatacagccaaatct
ttggccgactctttggaccgggctgaatctccggatttcccatacctgaatactctatta
aggatactggccactcgctgtatgatgcaagctgtgtacttctgctctgggatggataat
gattttcatcactatggcttagcctcccccatatacacacatttcacctctcctatcaga
agatatgcagacataattgtccatcggctattagctgtggcgattggggctgactgtact
taccctgagttgacagacaaacacaagctttcagatatatgtaaaaacctcaatttccgg
cataaaatggctcagtatgcccagcgtgcttcggtggcttttcatacacagttgtttttc
aaaagcaaaggaatagtaagtgaagaagcctatattctctttgtaaggaaaaatgcaatt
gtggtgttaattccaaagtatggcttagaaggtacagttttctttgaagaaaaagataaa
ccaaagccacgccttgcttacgatgatgagatcccttccctgagaatagaaggtacagtg
ttccatgtgtttgataaggttaaagtgaagatcacattagattcatcaaatcttcaacat
cagaaaatccgcatggcccttgtagaaccacagatcccaggaataaatattcctcctaat
gttgcagacaaggctcttactgcaccagggggaaagaagaggaagcttgagaagtag

DBGET integrated database retrieval system