KEGG   Mus musculus (mouse): 72674Help
Entry
72674             CDS       T01002                                 

Gene name
Adipor1, 2810031L11Rik, ACDCR1, CGI-45, Paqr1
Definition
(RefSeq) adiponectin receptor 1
  KO
K07297  adiponectin receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04920  Adipocytokine signaling pathway
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    72674 (Adipor1)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    72674 (Adipor1)
  09149 Aging
   04211 Longevity regulating pathway
    72674 (Adipor1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    72674 (Adipor1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HlyIII DUF4405 DUF962
Motif
Other DBs
NCBI-GeneID: 72674
NCBI-ProteinID: NP_001292998
MGI: 1919924
Ensembl: ENSMUSG00000026457
Vega: OTTMUSG00000021808
UniProt: Q91VH1 Q53YY4 Q3UPA4
Position
1; 1 E4
AA seq 375 aa AA seqDB search
MSSHKGSAGAQGNGAPSGNREADTVELAELGPLLEEKGKRAASSPAKAEEDQACPVPQEE
EEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPS
FRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGA
VLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLS
IVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQM
GWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQE
FRYGLEGGCTDDSLL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcccacaaaggctctgccggggcacaaggcaatggggctccttctggtaacaga
gaagctgacacagtggagctggctgagctggggcccctgctggaggagaagggcaagcgg
gcagccagcagcccagccaaggctgaggaagatcaagcatgcccggtgcctcaggaagag
gaggaggaggtgcgggtgctgacgcttcctctgcaagcccaccatgccatggagaagatg
gaggagttcgtgtataaggtctgggagggacgttggagagtcatcccgtatgatgtgctt
cctgactggctgaaagacaacgactacctgctacatggccacagaccacctatgccctcc
tttcgggcttgcttcaagagcatcttccgcatccacacagagactggcaacatctggaca
catctgcttggttttgtgctatttctctttctgggaatcttgacgatgctgagaccaaat
atgtacttcatggctcccctgcaggagaaggtggtcttcgggatgttcttcctgggcgcg
gtgctctgcctcagtttctcctggctcttccacactgtctactgtcattcagagaaggtc
tctcggactttttccaaactggactattcagggattgctctactgattatggggagcttc
gttccctggctctattactccttctactgctccccacagccgcggctcatctacctctcc
atcgtctgtgtcctgggcatctctgccatcattgtggcacagtgggaccggtttgccact
cccaagcaccggcagacaagagcaggagtgttcctgggacttggcttgagtggtgttgta
cccaccatgcactttactatcgctgagggctttgtcaaggccaccacggtgggccagatg
ggctggttcttcctcatggctgtgatgtacatcaccggcgccggcctgtatgctgctcgg
attcctgagcgcttcttccctggaaaatttgacatctggttccagtctcatcagattttc
cacgtcctggtggtggcagcagctttcgtccacttctatggtgtgtccaaccttcaggaa
ttccgttatggcctagaaggtggctgtaccgacgactcccttctctga

DBGET integrated database retrieval system