KEGG   Mus musculus (mouse): 72691
Entry
72691             CDS       T01002                                 

Gene name
Calhm2, 2810048G17Rik, Fam26b
Definition
(RefSeq) calcium homeostasis modulator family member 2
  KO
K19739  calcium homeostasis modulator protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    72691 (Calhm2)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   72691 (Calhm2)
SSDB
Motif
Pfam: Ca_hom_mod
Other DBs
NCBI-GeneID: 72691
NCBI-ProteinID: NP_598507
MGI: 1919941
Ensembl: ENSMUSG00000033033
Vega: OTTMUSG00000033093
UniProt: Q8VEC4 Q4VA34 Q3V3G1
Position
19; 19 C3
AA seq 323 aa
MAALIAENFRFLSLFFKSKDVMIFNGLVALGTVGSQELFSVVAFHCPCSPARNYLYGLTA
IGVPALALFLIGVILNNHTWNLVAECQYRRAKNCSAAPNFLLLSSILGRAAVAPVTWSVI
SLLRGEAYVCALSEFVDPSSLTAGDKGFPPAHATEVLARFPCGEGPANLSSFREEVSRRL
KYESQLFGWLLIGVVAILVFLTKCLKHYCSPLSYRQEAYWAQYRTNEDQLFQRTAEVHSR
VLAANNVRRFFGFVALNKDDEELVAKFPVEGTQPRPQWNAITGVYLYRENQGLPLYSRLH
KWAQGLTGNGTAPDNVEMALLTA
NT seq 972 nt   +upstreamnt  +downstreamnt
atggcggccttgattgcagagaacttccgcttcctgtctctcttcttcaagagcaaggat
gtgatgattttcaatgggctggtggccctgggcacggtgggcagtcaggagctgttctca
gtggtggccttccactgtccctgctcacccgcccggaactacctgtatggactgacagca
attggcgtgcctgcgctggccctcttccttatcggagtcattctcaacaaccacacttgg
aacctagtcgccgagtgccagtaccggagggccaagaactgctccgcggcccccaacttc
ctcctcctaagctcaatcctgggccgtgcagctgtggctccagtcacctggtctgtcatc
tccctgctccgaggggaggcctatgtctgtgctctcagtgagtttgtggacccctcctcg
ctcacagctggggataaaggcttccccccagcccatgctacggaggtcctagccaggttc
ccttgtggagagggccccgccaacctatcgagcttccgagaggaggtcagccgcaggctc
aagtatgagtctcagctcttcggatggctgctcatcggtgtggtggccatcctggtgttc
ctgaccaagtgcctcaaacattactgctcgccactcagctaccgtcaggaggcctactgg
gctcagtaccgtaccaacgaggaccagttgttccagcgcacagcagaggtgcattcgagg
gtgctggccgccaacaacgtgcgccgtttctttggctttgtggctctcaacaaggatgac
gaagagctggtcgccaagttcccagtggaaggcacacagccacggccacagtggaacgct
atcactggggtctatctgtaccgagagaaccagggcctcccactctacagccgcctacac
aagtgggcccagggtctgacaggtaatggcacagcccctgacaatgtggagatggccctg
ctcactgcttaa

DBGET integrated database retrieval system