KEGG   Mus musculus (mouse): 72736Help
Entry
72736             CDS       T01002                                 

Gene name
Tmx1, 2810425A04Rik, Txndc1
Definition
(RefSeq) thioredoxin-related transmembrane protein 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin FAM176 TMEM51 OST3_OST6 Thioredoxin_2 Pox_Ag35 DUF4719
Motif
Other DBs
NCBI-GeneID: 72736
NCBI-ProteinID: NP_082615
MGI: 1919986
Ensembl: ENSMUSG00000021072
Vega: OTTMUSG00000034933
UniProt: Q8VBT0
Position
12; 12 C2
AA seq 278 aa AA seqDB search
MAHLGRLMVPLAALVLLLWAVPGAHGRRNNVRVLTDENWTSLLEGEWMIEFYAPWCPACQ
NLQPEWESFAEWGEDLEVKVAKVDVTEQTGLSGRFIITALPSIYHCKDGEFRRYVGPRTK
KDFINFVSDKEWKNIEPISSWFGPSSVLMTMMSALFQLSVYIRTSHSYFVHDLGIPAWGS
YLVFAFATVLSGLLLGLCMIFVADCLCPSKRRKPQQQYAKKTSPEFSQPLKKVEEEQEAD
EEDVSEEEAEDREGASKATSQSSIRQRCVGLPSATDTS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacttggggcgtcttatggttcccctggcagctctggtcctgctgctctgggcg
gtccctggggcccacggacggcggaataacgtgcgcgtcctcaccgatgagaactggacg
tcgttgctggaaggagagtggatgatagaattttatgctccctggtgtcctgcttgtcag
aatcttcagccagaatgggaaagttttgccgagtggggagaagatcttgaggtgaaagtt
gcaaaagtggatgtcacagagcagacaggactaagtggacggtttatcataactgctctt
ccttctatttatcattgtaaagatggtgaatttaggcgctatgtgggcccaaggactaag
aaggacttcataaacttcgtaagtgataaagaatggaagaatattgaacctatatcatca
tggtttggtccaagttctgttctgatgactatgatgtcagcactttttcaactctctgtg
tacatcaggactagccacagctattttgttcatgaccttggaataccagcgtggggttca
tacttggtttttgcttttgccacagtactctcaggactgctgctgggactttgtatgata
tttgtagcagattgcctttgcccttcaaaaagacgcaaaccacagcaacagtatgcaaaa
aaaacatcaccagaattttctcaacctctgaaaaaagtggaggaagagcaggaggctgat
gaagaagatgtttcagaagaggaggcagaagatagagagggagcaagcaaagccacttct
cagagcagcataagacaacgctgtgtgggcctcccatctgccacggacacatcctaa

DBGET integrated database retrieval system