KEGG   Mus musculus (house mouse): 72736
Entry
72736             CDS       T01002                                 
Symbol
Tmx1, 2810425A04Rik, Txndc1
Name
(RefSeq) thioredoxin-related transmembrane protein 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Thioredoxin FAM176 TMEM51 OST3_OST6 Thioredoxin_2 Pox_Ag35
Other DBs
NCBI-GeneID: 72736
NCBI-ProteinID: NP_082615
MGI: 1919986
Ensembl: ENSMUSG00000021072
Vega: OTTMUSG00000034933
UniProt: Q8VBT0
Position
12:70499928..70514398
AA seq 278 aa
MAHLGRLMVPLAALVLLLWAVPGAHGRRNNVRVLTDENWTSLLEGEWMIEFYAPWCPACQ
NLQPEWESFAEWGEDLEVKVAKVDVTEQTGLSGRFIITALPSIYHCKDGEFRRYVGPRTK
KDFINFVSDKEWKNIEPISSWFGPSSVLMTMMSALFQLSVYIRTSHSYFVHDLGIPAWGS
YLVFAFATVLSGLLLGLCMIFVADCLCPSKRRKPQQQYAKKTSPEFSQPLKKVEEEQEAD
EEDVSEEEAEDREGASKATSQSSIRQRCVGLPSATDTS
NT seq 837 nt   +upstreamnt  +downstreamnt
atggcgcacttggggcgtcttatggttcccctggcagctctggtcctgctgctctgggcg
gtccctggggcccacggacggcggaataacgtgcgcgtcctcaccgatgagaactggacg
tcgttgctggaaggagagtggatgatagaattttatgctccctggtgtcctgcttgtcag
aatcttcagccagaatgggaaagttttgccgagtggggagaagatcttgaggtgaaagtt
gcaaaagtggatgtcacagagcagacaggactaagtggacggtttatcataactgctctt
ccttctatttatcattgtaaagatggtgaatttaggcgctatgtgggcccaaggactaag
aaggacttcataaacttcgtaagtgataaagaatggaagaatattgaacctatatcatca
tggtttggtccaagttctgttctgatgactatgatgtcagcactttttcaactctctgtg
tacatcaggactagccacagctattttgttcatgaccttggaataccagcgtggggttca
tacttggtttttgcttttgccacagtactctcaggactgctgctgggactttgtatgata
tttgtagcagattgcctttgcccttcaaaaagacgcaaaccacagcaacagtatgcaaaa
aaaacatcaccagaattttctcaacctctgaaaaaagtggaggaagagcaggaggctgat
gaagaagatgtttcagaagaggaggcagaagatagagagggagcaagcaaagccacttct
cagagcagcataagacaacgctgtgtgggcctcccatctgccacggacacatcctaa

DBGET integrated database retrieval system