KEGG   Mus musculus (house mouse): 72789
Entry
72789             CDS       T01002                                 
Symbol
Veph1, 2810471M23Rik, Veph
Name
(RefSeq) ventricular zone expressed PH domain-containing 1
  KO
K24027  protein melted
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    72789 (Veph1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   72789 (Veph1)
SSDB
Motif
Pfam: PH PH_9 PH_11
Other DBs
NCBI-GeneID: 72789
NCBI-ProteinID: NP_665819
MGI: 1920039
Ensembl: ENSMUSG00000027831
UniProt: A1A535
Position
3:complement(65960979..66204370)
AA seq 833 aa
MHQLFRLVLGQKDLSKAGDLFSLDDAEIEDSLTEALEQIKVISSSLDYQTNNNDQAVVEI
CITRITTAIRETESIEKHARALVGLWDSCLEHNLRPAGKDEDTPHAKIASDIMSCILQNY
NRTPVMVLAVPIAVKFLHRGSKELCRNMSNYLSLAAITKADLLADHTEGIIKSILQGNAM
LLRVLPAVYEKQPQPINRHLAELLALMSQLEQTEQYHLLRLLHVAAKRKDVEVVQKCVPF
LIRNLKDSTYNDIILNILIEIAGHEPLALNSFLPMLKEIAEQFPYLTGQMARIFGAVGHV
DEERARSCLRYLVSQLANMEHPFHHILLLEIKSITDAFSSILGPHSRDIFRMSNSFTNIA
KLLSRQLENSKADSSRRKTSTEVSIPEKLRELNSMEPESEDHEKLQVKIQAFEDKINAES
NTPGSGRRYSLDHISKEERKSIRFSRSRSLALNTVLTNGVSVEDNEVEEKAGMHASISLS
QIDPLSHGIGKLPFKTDTHGSPLRNSSASHPSIIHTEPETMPETFKENIQEEILEAATSP
IEYQDKLYLHLRENLSKVKAYALEIAKKVPIPDQCTIEDTMRSCVAKLFFTCSLKGHYCL
YSKSSFILVSQAPQPWIQVMFLSQQSLFPEPLSIQSGSVQFLKALWEKTQDTGAHSFEVA
MTESTFPQQKDLEQLQLHLEEVRFFDVFGFSETAGAWQCFMCNNPEKATVVNQDGQPLIE
GKLKEKQVRWKFIKRWKTHYFTLAGNQLLFQKGKSKDDPDDSPIELSKVQSVKAVAKKRR
DRSLPRAFEIFTDSKTYVFKAKDEKNAEEWLQCINVALAQAKERESREVTTYL
NT seq 2502 nt   +upstreamnt  +downstreamnt
atgcatcaacttttcagattggttttgggacaaaaagatctttcaaaagctggggacctc
ttctctttagatgatgctgagattgaagacagcctgacagaagctttggagcagattaaa
gtaattagctcatctttggattaccaaactaataacaatgaccaggcggtggttgaaatc
tgtatcacaaggattaccacagccatcagagagacagaatccattgaaaagcatgccaga
gccctggtggggctgtgggattcctgcttggaacacaacctgagacctgcagggaaagac
gaagatactccacatgcaaaaatcgcctctgatatcatgagttgcatcttacagaattac
aaccggacccctgtgatggtcttagctgtccccatcgcagtgaaattcctccacagaggc
agcaaggagctgtgtaggaacatgtccaactacctgtccctggctgccatcaccaaggcg
gatctgctggctgaccacactgaagggataataaagagcatactccaaggaaatgccatg
ctgttaagggtgctacctgctgtatatgaaaagcagccccaaccaatcaacagacacctg
gcagaactcctggccttgatgtctcaattggagcagacagaacagtaccatctactaagg
cttctgcacgtagcagcaaagagaaaagatgtggaggtggttcagaaatgtgttcctttc
ctgatcagaaatttgaaggattcaacctataatgacatcatcctaaacattctcatagaa
atagcaggccatgagccactggccttgaacagtttcctcccgatgctgaaagagattgca
gagcaattcccctacctcactggacagatggcaaggatctttggtgctgttggtcatgtg
gatgaagagagagccaggagctgcctacgatacctggtgagccagctggctaatatggag
catccattccaccatattctcctgctggaaattaagagtatcacagatgccttctcctcc
atcctgggcccgcacagcagggacatcttccgaatgagcaacagcttcaccaacattgcc
aagctcctttccagacaactggaaaacagcaaggctgacagtagcaggagaaaaaccagc
actgaagttagcattcctgagaaactgagagaactcaattccatggagcctgaaagtgaa
gaccatgaaaaactccaagttaaaatccaagcctttgaagacaaaataaatgctgagagc
aataccccaggctctggccggagatacagcttagaccacatctctaaggaagaacgaaaa
agcattagatttagcaggtccagaagtttggctttgaatactgtgctcacaaacggtgtg
agtgtggaagataacgaagtcgaagaaaaggcaggaatgcacgccagcatctctctttcg
caaatagacccactcagccacgggattggcaagttgccctttaagacagacactcatgga
tcaccactgagaaattcctcagcttcacacccaagtattatacatactgaaccagagact
atgcccgaaacttttaaagaaaacatccaagaagaaattctagaggcagccacaagtcct
attgaataccaagataagctctacttgcatttaagggaaaacctcagcaaagtgaaggct
tatgccttggaaatcgcaaaaaaggtcccaatcccagaccagtgcaccattgaagatact
atgagaagttgcgtggcaaagctgttctttacctgttctttaaagggccattactgccta
tacagcaagtccagcttcatccttgtcagccaagcaccccagccgtggatccaggtcatg
tttctctcccaacagagcctgtttcctgagcccctgtccattcagagtgggtctgtgcag
ttcctcaaagccctatgggagaaaacgcaggacacgggagcgcacagctttgaagtcgcc
atgacagagtccacctttccacagcagaaggatctggagcagcttcagctccatctggaa
gaagtgcggttcttcgacgtgtttggcttcagtgaaacagcgggggcatggcagtgcttc
atgtgcaacaaccctgaaaaggcaactgttgtaaatcaagatggccagcctctcatcgaa
ggaaaacttaaggagaaacaagtgaggtggaagttcatcaagaggtggaaaacgcattat
tttacactggccggaaaccaacttctgtttcaaaaggggaaatctaaggatgaccctgat
gattccccgatagaactcagcaaggtacagagcgtgaaagctgtggctaagaaacgccgg
gaccgctctctgcctcgggcgtttgaaatcttcacagatagtaagacctatgttttcaaa
gccaaggatgagaagaacgcagaggaatggctgcagtgcatcaacgtggcgctggcccag
gcaaaggagagggaaagccgagaagtaaccacatatctgtag

DBGET integrated database retrieval system