KEGG   Mus musculus (mouse): 72821Help
Entry
72821             CDS       T01002                                 

Gene name
Scn2b, 2810451E09Rik, AI840361, Gm183
Definition
(RefSeq) sodium channel, voltage-gated, type II, beta
  KO
K04846  voltage-gated sodium channel type II beta
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    72821 (Scn2b)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   72821 (Scn2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set ig Ig_3 I-set Adeno_E3_CR2 Syndecan EphA2_TM PALP Ig_2 Mqo FAM176 SKG6
Motif
Other DBs
NCBI-GeneID: 72821
NCBI-ProteinID: NP_001014761
MGI: 106921
Ensembl: ENSMUSG00000070304
Vega: OTTMUSG00000063452
UniProt: Q56A07 Q1MXF8
Position
9 A5.2; 9 24.84 cM
AA seq 215 aa AA seqDB search
MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTAPTTLSVLNGSDTRLPCTFNSCYTVNH
KQFSLNWTYQECNNCTEEMFLQFRMKIINLKLERFGDRVEFSGNPSKYDVSVTLKNVQLE
DEGIYNCYITNPPDRHRGHGKIYLQVLLEVPPERDSTVAVIVGASVGGFLAVVILVLMVV
KCVRRKKEQKLSTDDLKTEEEGKMDGEGNAEDGTK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcacagggatgcctggctacctcgccctgccttcagtctcacggggctcagtctgttt
ttctctttggtgcccccggggcggagcatggaagtcacagcgcccaccactcttagtgtc
ctcaatgggtccgatacccgcctgccctgtaccttcaactcctgctacaccgtgaaccac
aagcagttctctcttaactggacttaccaggagtgtaacaattgcacagaggagatgttc
ctccagttccgaatgaagatcattaacctgaagctggagcggtttggagaccgcgtggag
ttctcagggaaccccagtaagtacgacgtgtcagtgactctaaagaacgtgcagctagaa
gacgaaggcatttacaactgctacattaccaaccctccagaccgccaccgcggccacggc
aagatttacctgcaggtccttctagaagtacccccagagcgggactccacggtggcggtc
atcgtgggtgcctcagtggggggtttcctggctgtggtcatcttggtgctgatggtggtc
aaatgtgtgaggaggaaaaaagagcagaagctgagcacggatgacctgaagactgaagag
gaaggcaagatggatggtgagggcaacgcggaagatggcaccaagtaa

DBGET integrated database retrieval system