KEGG   Mus musculus (house mouse): 72826
Entry
72826             CDS       T01002                                 
Symbol
Fam76b, 2810485I05Rik
Name
(RefSeq) family with sequence similarity 76, member B
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: FAM76 MPS2 Macoilin Kinesin_assoc
Other DBs
NCBI-GeneID: 72826
NCBI-ProteinID: NP_789806
MGI: 1920076
Ensembl: ENSMUSG00000037808
UniProt: Q80XP8
Position
9:13738490..13766033
AA seq 339 aa
MAASALYACTKCTQRYPFEELSQGQQLCKECRIAHPIVKCTYCRSEFQQESKTNTICKKC
AQNVKQFGTPKPCQYCNIIAAFIGTKCQRCTNSEKKYGAPQTCEQCKQQCAFDRKEEGRR
KVDGKLLCWLCTLSYKRVLQKTKEQRKSLGSSHSNSSSSSLTEKDQHHSKHHHHHHHHHH
RHSSGHHKVSSLSPEQEQGLWKQSHKSSAAIQNETPKKKPKLESKPSNGDSSSINQSADS
GGTDNFVLISQLKEEVMSLKRLLQQRDQTILEKDKKLTELKADFQYQESNLRTKMNSMEK
AHKETVEQLQAKNRELLKQVAALSKGKKFDKSGSVLTSP
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcggcgtcggccttgtacgcctgcaccaagtgcacgcagcgctaccccttcgaggag
ctctcgcagggccaacagctctgcaaggaatgtcggattgcacatcctattgtaaaatgt
acttactgcagatcagaatttcagcaggagagtaaaactaacacaatttgtaagaagtgt
gctcaaaatgtcaagcaatttggaacacctaagccttgtcagtactgtaacataattgca
gcatttattggtaccaagtgtcagcgttgtacaaattcagaaaagaaatatggagcacct
cagacctgtgagcagtgcaaacagcagtgtgcttttgatcgcaaggaggaaggaagaagg
aaagttgatgggaagttgctgtgctggctctgcaccttgtcatacaagagagttttacag
aagacaaaagaacagaggaagagtttggggtcttcacattctaactcctcatcttcatct
cttactgagaaagaccagcaccattctaaacaccaccaccaccaccaccatcaccatcac
cgccacagcagtggccaccacaaagtcagcagtctaagtcctgagcaggagcagggactg
tggaaacagagccataaatcctctgcagcaattcagaatgaaactccaaagaaaaagccc
aagttggaatctaagccatctaatggagatagtagctctataaatcagtcagcagatagt
gggggaacagacaattttgtccttatcagtcaactgaaagaagaagtgatgtcacttaaa
cgtctcttacagcaaagagaccagactattttggaaaaagataaaaagttaactgaactg
aaggcagactttcaataccaagagtcaaatttgaggactaagatgaacagtatggaaaaa
gcgcacaaagaaactgtggaacaactccaggccaaaaacagagaactactcaaacaggtt
gcagccttgtctaagggtaaaaagtttgacaagagtggaagcgtgctaacatctccctga

DBGET integrated database retrieval system