KEGG   Mus musculus (mouse): 72843Help
Entry
72843             CDS       T01002                                 

Gene name
Prdm4, 1700031E19Rik, 2810470D21Rik, AW552272, SC-1, SC1
Definition
(RefSeq) PR domain containing 4
  KO
K12463  PR domain zinc finger protein 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    72843 (Prdm4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf_PR_Knuckle zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-met zf-H2C2_5 zf-C2H2_jaz Mu-like_Com
Motif
Other DBs
NCBI-GeneID: 72843
NCBI-ProteinID: NP_857633
MGI: 1920093
Ensembl: ENSMUSG00000035529
UniProt: Q80V63
Position
10; 10 C1
AA seq 803 aa AA seqDB search
MNDMNLSPVGMEQLSSSSVSNALPVSGSHLGLAASPSHSAIPAPGLPVAIPNLGPSLSSL
PSALSLMLPVGIGDRGVMCGLPERNYTLPPPPYPHLESSYFRTILPGILSYLADRPPPQY
IHPNSINVDGNTALSITNNPSALDPYQANGNVGLELGIVSIDSRSVNTHGAQSLHPNDGH
EVALDTTITMENVSRVTSPISTDGMAEELTMDGVTGEHPQIPNGSRSHEPLSVDSVSNSL
TAEAVGHGGVIPIHGNGLELPVVMETDHIANRVNGMSDSTLSDSIHTVAMSTNSVSVALS
TSHNLASLESVSLHEVGLSLEPVAVSSITQEVAMGTGHVDVSSDSLSFVPSSLQMEDSNS
NKENMATLFTIWCTLCDRAYPSDCPDHGPVTFVPDTPIESRARLSLPKQLVLRQSIVGTD
VVGVLPLIGVWTAETIPVRTCFGPLIGQQSHSLEVAEWTDKAVNHVWKIYHTGVLEFCII
TTDENECNWMMFVRKARNREEQNLVAYPHDGKIYFCTSQDIPPESELLFYYSRNYAQQIG
VPEHPDVHLCNCGKECSSYSEFKAHLTSHIHNHLPSQGHSSSHGPSHSKERKWKCSMCPQ
AFISPSKLHVHFMGHMGMKPHKCDFCSKAFSDPSNLRTHLKIHTGQKNYRCTLCDKSFTQ
KAHLESHMVIHTGEKNLKCDYCDKLFMRRQDLKQHVLIHTQERQIKCPKCDKLFLRTNHL
KKHLNSHEGKRDYVCEKCTKAYLTKYHLTRHLKTCKEPSSSSSAQEEEDDESEEEDLADS
MRTEDCRMGSAVYSTDESLSAHK
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacatgaacttgagcccagtggggatggagcagctgtcttcatcctctgtgagc
aatgccctgccagtctcaggaagtcacctgggcttggctgcctctccctctcacagtgcc
atccctgccccaggacttccagtggcaattccaaacctgggtccctccctgagctctctg
ccttctgccttgtctcttatgctccccgtgggcattggagaccgaggagtgatgtgtggg
ctacctgagaggaactacaccctacctccacctccttaccctcacctagagagcagttac
ttcagaaccattctacctggcattttatcttatttagctgacagaccacctcctcagtat
atccaccccaactctataaatgttgatggaaatacagcattatctatcaccaacaaccct
tcagcactagatccgtatcaggccaatggaaatgttggattagaactaggcattgtttca
atagactctcgctctgtaaacacacatggtgcccaaagtcttcatcctaatgatggccac
gaagtagcattggacacaacaatcaccatggagaatgtttctagggttaccagcccaatc
tccacagatggaatggcagaggagcttacaatggacggtgttacaggagagcatccccaa
atcccaaatggctccagaagtcatgagcctctctctgtggattctgtgagcaacagcctt
acagcagaagctgtaggacatggtggtgtgatacccattcacgggaatggtctggagctt
cctgtggtcatggaaactgaccacattgcaaaccgggtcaatgggatgtctgacagtacc
ctcagtgactccatccacaccgtggccatgagcaccaactctgtaagcgtggcactctct
acctcacacaacctggcctccctagagtctgtttccctccatgaagttggccttagccta
gagcctgtggctgtctcttctatcacgcaggaggttgccatggggacaggtcatgtagat
gtgtcctcagacagcttgtcttttgtaccatcttcactgcaaatggaagactccaattca
aacaaggaaaacatggcaaccttgtttacaatttggtgcactctttgtgaccgagcctac
ccctcagattgccctgatcatggaccagtgacttttgttcctgacacaccaatagagagc
agagcaagactatccctcccgaagcagcttgttctccgccagtccatcgtgggaacagat
gttgttggtgtccttccattgataggtgtatggactgcagaaaccattcctgtgcggact
tgcttcggacctctaattggtcagcagagtcactccttggaagtagcagagtggacagac
aaggcagttaaccatgtctggaagatataccacactggtgtcctggagttctgtatcatt
acaaccgatgagaatgagtgtaattggatgatgtttgtgcgcaaagccaggaaccgtgaa
gaacagaatttggtggcctatccccatgatgggaaaatctatttctgtacctcacaagac
atcccccctgaaagtgagctgcttttctattacagccggaattacgctcaacagataggt
gttcctgaacacccagatgtgcacctctgtaactgtggcaaggagtgcagttcctattca
gagttcaaagctcatctgaccagccatatccacaatcatctccctagccagggccacagc
agcagccatgggccaagccacagcaaggaaaggaagtggaagtgttcaatgtgcccccag
gcttttatctcgccttccaaactccacgttcactttatgggccacatgggtatgaagccc
cacaagtgtgatttttgtagcaaggcttttagtgatccaagcaacctacggacacacctc
aaaatacatacaggtcagaaaaattataggtgtactttgtgtgacaagtctttcacgcag
aaggctcacctggagtctcacatggtcatccacacgggtgagaagaatctcaagtgtgat
tactgtgacaagctgttcatgcggagacaggacctcaagcagcacgtgctcatccacacg
caagaacgccagatcaagtgtccgaagtgtgataaactgttcttgagaacaaaccacttg
aagaagcatctcaattctcacgaaggaaaacgagattatgtctgcgaaaaatgtacaaag
gcttatctaaccaagtaccatctcactcgccacctgaagacctgcaaagagcccagctcc
agctcctctgcacaggaggaagaggatgatgagtcggaggaagaagatctcgcagactcc
atgaggacagaggactgcaggatgggcagtgctgtttactcaacagacgagtctctctcc
gcacataaatag

DBGET integrated database retrieval system