KEGG   Mus musculus (mouse): 72852
Entry
72852             CDS       T01002                                 

Symbol
Mblac2, 2900024O10Rik
Name
(RefSeq) metallo-beta-lactamase domain containing 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Lactamase_B ODP Lactamase_B_2 DUF4943
Other DBs
NCBI-GeneID: 72852
NCBI-ProteinID: NP_082648
MGI: 1920102
Ensembl: ENSMUSG00000051098
UniProt: Q8BL86
Position
13; 13 C3
AA seq 279 aa
MSALEWYAHKSLGDGIFWIQERFYESGNRANIWLVRGSEQDVVIDTGLGLRSLPEYLYSS
GLLQDCGSKEDAGRRPLLAVATHVHFDHSGGLYQFDQVAVHRAEAEALARGDNFETVTWL
SDSEVVRAPSPGWRARQFRVQAVQPTLILQDGDVINLGDRQLTVMHMPGHSRGSICLHDK
DRKVLFSGDVVYDGSLIDWLPYSRISDYVGTCERLIELVDRGLVEKVLPGHFNTFGAERL
FRLASNYISKAGICHKVSTFAMRSLASLALRVTNPRTSP
NT seq 840 nt   +upstreamnt  +downstreamnt
atgtcggcgctcgagtggtatgcccacaagtctctgggcgatggcatcttctggattcaa
gaacggttctacgagtcaggcaaccgggccaacatttggctggtgcgcggctcggagcag
gacgtggtgatagacactggcctggggctgcgcagccttccggagtacctctactcctct
ggcctcttgcaggattgcgggtctaaagaggatgcaggacgccggccactgctggccgtg
gccacccacgtgcacttcgatcactccggcggtctctatcagttcgaccaggtggctgtg
caccgcgccgaggccgaggccctggctcgcggggacaactttgagaccgtgacctggctt
tctgacagcgaggtggtgcgggcgcccagccctggctggagggccaggcagttccgagtg
caggcagtgcaacccaccctcattctgcaggatggggatgtgatcaaccttggcgacaga
cagctcactgttatgcacatgccaggtcactccagaggcagtatttgcttacatgataaa
gaccgtaaggtgctcttcagtggtgacgtcgtgtatgatggatcactgattgactggctc
ccatacagcaggatcagtgactatgttggaacttgtgagcgtctcatagagttggtggac
cgaggccttgtggagaaggtgcttcctgggcacttcaatacctttggtgccgaaaggctg
tttcgcttagcttctaactatatttcaaaagctgggatatgccacaaagtgtctactttt
gccatgaggtctcttgcaagtttagctctccgtgtaacaaatcctaggacctcaccctag

DBGET integrated database retrieval system