KEGG   Mus musculus (house mouse): 72865
Entry
72865             CDS       T01002                                 
Symbol
Rtl8c, 2900027G03Rik, Cxx1c, Mar8.1, Mart8a
Name
(RefSeq) retrotransposon Gag like 8C
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: DUF4939 Ty3_capsid
Other DBs
NCBI-GeneID: 72865
NCBI-ProteinID: NP_082651
MGI: 1920115
Ensembl: ENSMUSG00000051851
UniProt: Q9D6I0
Position
X:52609889..52611102
AA seq 112 aa
MDRRIKLIMALMAWPELRKGRWQNPIPFPELFDGEMEKLPEFIVQTLSYMLVDEKTFDTD
KRKVMFLITRLKGRALQWAMRYLQTDSPMLNNYSGFLNEMKEEFGWEEDEDF
NT seq 339 nt   +upstreamnt  +downstreamnt
atggaccgccggattaagttgattatggccctcatggcctggcccgagctgcgtaaaggc
cgttggcagaaccccatcccatttcctgagctgtttgatggcgagatggagaagctcccg
gagttcatcgtgcagaccctgtcctacatgttagtagatgagaagaccttcgacaccgac
aaacgcaaggtgatgttcctcatcacccgcctcaagggccgggccctgcagtgggctatg
cgctatctccagacagacagccccatgctcaacaattactccggcttcctgaatgagatg
aaggaggagttcgggtgggaggaggatgaggacttctag

DBGET integrated database retrieval system