KEGG   Mus musculus (house mouse): 72873
Entry
72873             CDS       T01002                                 
Symbol
Bbof1, 2900006K08Rik, Ccdc176
Name
(RefSeq) basal body orientation factor 1
  KO
K25473  basal body-orientation factor 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    72873 (Bbof1)
Cilium and associated proteins [BR:mmu03037]
 Motile cilia and associated proteins
  Other motile cilia associated proteins
   72873 (Bbof1)
SSDB
Motif
Pfam: DUF4515 FapA Tup_N
Other DBs
NCBI-GeneID: 72873
NCBI-ProteinID: NP_082653
MGI: 1920123
Ensembl: ENSMUSG00000057265
UniProt: Q3V079
Position
12:84455243..84488279
AA seq 533 aa
MPAKDKRKDKRKDKRKGKNKGKEPKKIIKSDEPAIERAKANASLWEARLEVTELSRIEYR
DTSRRLAKNNEDLKKQQYNMEKDIMSVLSYLKKQDQEKDNMIEKLKQQLAKTKEKAQEEK
EKLEQKYALQVSELEGQFHQKAKEIGMIQTELKTIKQFQKRKIQVEKELDDLKENLRNSE
KNYQETLRRLESRFFEEKHRLEQEAEKRIIMLAERAHHEAVVQLNTAGRNVFKENVYLHK
ALAYHLKEAEILQQNSKKIEENHSCLLQQKEINDLLVKEKIMQLTQQKSQIQTLQKKVVS
LENALTYMTTEFEAEVLKLQQKAIIENQAGLVEIDKLQQLLQMKDREMNRVKRLAKNILD
ERTEVEQFFLDALYEVKQQILASRKHYKQIAQAAFNLKMRAACAGKTEYPRIRTFDGKEQ
STNSVNQDLLEAEKWPTTQKNVDIRDLTWEQKEKVLRLLFAKMNGFAARKYSQSSKPPVP
DHIIYGSGEMKETGDENNLLDQTFITQQAPVSDSNRMVSPDVIPQGLQDSDIA
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgccggcgaaggacaagaggaaagacaagaggaaagacaagaggaaaggcaaaaacaaa
ggcaaagaaccaaagaaaataatcaaatcagatgaacctgcaattgaaagagccaaagcc
aatgcctctctttgggaggccagattggaagtcacagaactctctaggattgaatatcgt
gatacttcccgaagactggcaaaaaataatgaagacttaaagaaacagcaatataacatg
gaaaaagacattatgtctgtattaagctacttgaagaagcaggatcaagagaaagataat
atgatagaaaaactgaagcagcagttggctaaaacaaaggaaaaagcccaggaagagaag
gaaaaattggaacaaaagtatgctctgcaagtgagtgagttggagggacagtttcatcaa
aaagccaaggaaatcggcatgattcagacagagctaaagacaataaaacaattccagaag
agaaaaatacaagtggagaaagaattagatgatctgaaagaaaatttaaggaactcagag
aagaactatcaggagactcttagaagactagaaagcagattttttgaagaaaagcaccgt
ttggagcaagaggctgagaagaggatcataatgctggcagagagagctcaccatgaagct
gtagtgcagttgaacactgctggaagaaatgttttcaaagagaatgtttatcttcacaag
gcgcttgcataccacttgaaggaagctgaaattctccagcaaaactccaagaagattgaa
gaaaaccattcctgccttttacaacaaaaggaaatcaatgatctgttggttaaggaaaag
attatgcaactcacccagcagaaatcacaaatccaaactctccagaagaaggtggtaagc
ttggagaacgctctgacctacatgaccacagagtttgaggctgaagtgttgaaactgcag
caaaaggcaatcatagagaaccaagcaggcttggtagagattgacaagctgcagcaactt
cttcagatgaaggacagggagatgaaccgagtgaagaggctggctaagaacatactggat
gagaggacagaagtggaacagttctttctagacgctctctacgaagtgaagcaacagatt
ctggccagcaggaagcattataagcagatagcacaagctgctttcaatttaaaaatgaga
gcagcatgtgcgggaaaaacagaatatcccagaatcaggacctttgatggcaaagaacaa
agtaccaatagtgtgaaccaggatctcttggaggctgaaaaatggccaactactcaaaaa
aatgtggatattagagatttgacctgggagcagaaggaaaaggtcttaagattgctcttt
gcaaaaatgaatggttttgctgctaggaaatacagtcagagttctaagcctcctgttcca
gaccatattatttatggcagtggagaaatgaaagaaactggggatgaaaataaccttcta
gatcaaaccttcatcacccagcaagcgccagtatcagactccaatagaatggtgtcaccc
gatgttattcctcaaggattacaggactctgacatagcctag

DBGET integrated database retrieval system