KEGG   Mus musculus (mouse): 72886Help
Entry
72886             CDS       T01002                                 

Gene name
Yju2, 2900016D05Rik, AI413813, Ccdc94
Definition
(RefSeq) YJU2 splicing factor
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF572
Motif
Other DBs
NCBI-GeneID: 72886
NCBI-ProteinID: NP_082657
MGI: 1920136
Ensembl: ENSMUSG00000003208
UniProt: Q9D6J3
Position
17; 17 D
AA seq 314 aa AA seqDB search
MSERKVLNKYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYIYKGKKFNARK
ETVQNEAYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQAEKLLEEEEKR
VQKEREDEELNNPMKVLENRTKDSKLEMEVLENLQELKDLNQRQAHVDFEAMLRQHRMSQ
EQWQQQQEEEDERETAALLEEARHRRLLEDSESEDEAPPSRPRAAARPNPTAILNEVPQT
KRKAEALCSKAQLAGLVVPKKVKTEANGASEQVGVPTAAGAPKSRKADNPTPQTPGTSSL
SQLGAYGDSEDSDS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaacggaaagttttaaacaaatactacccacctgactttgacccatcgaagatc
ccgaaactcaagctacccaaggaccggcagtatgtggtgcgtctgatggcccccttcaac
atgaggtgtaagacgtgtggagaatacatctacaaggggaagaagttcaatgcacgaaag
gaaacagtccagaacgaggcttacctgggcctgccaatcttccgattctacatcaagtgc
acgcgctgcttggccgagatcaccttcaagacggacccagagaacacggactacaccatg
gagcacggggccacgcgcaacttccaggcggagaagcttctggaggaggaggagaagcgc
gtgcagaaggagcgagaggatgaggaactgaacaaccccatgaaggtcctagagaaccgg
acgaaggactccaagctggagatggaagtgctggaaaacctgcaagagctgaaagacctg
aaccagcggcaggcgcatgtggactttgaggccatgctgcggcagcaccgcatgtctcag
gagcagtggcagcagcagcaggaggaggaagacgagcgggagacagcggccttgctggag
gaggctcgccatcgaaggcttctggaggactctgagtcagaggatgaggcgccaccttcc
cgaccacgggcagctgcaagacccaaccccacagccatcctcaacgaggtaccgcagacc
aagaggaaggcagaggccctgtgcagtaaagcacagttggcaggcttagttgtaccaaag
aaggtaaagacagaagccaacggcgcctcagagcaggtcggggtgcccaccgccgcaggt
gcccccaagagcaggaaggcggacaaccctacaccccagacacctggcacgtcctccctg
agccagctgggtgcatatggggacagcgaggacagcgacagctga

DBGET integrated database retrieval system