KEGG   Mus musculus (mouse): 72891
Entry
72891             CDS       T01002                                 

Symbol
Xlr4c, 2900036K24Rik
Name
(RefSeq) X-linked lymphocyte-regulated 4C
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Cor1 YkyA YlbD_coat Phage_term_smal DUF2145 KxDL
Other DBs
NCBI-GeneID: 72891
NCBI-ProteinID: NP_898917
MGI: 3574099
Ensembl: ENSMUSG00000031362
Vega: OTTMUSG00000017663
UniProt: Q3TKR2
Position
X; X A7.3
AA seq 215 aa
MASKIKGRPPKQPKVTPALPSNDSQQLHENNPGNNLALETCGESSSSHGTGGPKPGPSKK
TLNERKRKYGVSVNKTVQNIEWNVDHFLKVQHERRQELYKDYSHQFLTLVMMWNIDVDQI
KKQAGKLSDILDEQQKLFQQFQSIHMQKIEEFKELCDRHLKNLQAIKCCRRKAIIEEARK
LMDYLEKRVTEETVHVNKQEAKDGVQSSLLSLLFS
NT seq 648 nt   +upstreamnt  +downstreamnt
atggcttccaaaatcaagggcagacctcccaagcaaccaaaggtgactcctgctctgcca
tctaatgattcacagcagcttcatgaaaataacccaggaaacaatctggcccttgaaact
tgtggggaaagcagttcttcccatggaacaggtggaccaaagccagggcccagtaagaaa
actctaaatgaaaggaagagaaagtatggggtgagtgtaaataaaactgtccaaaacatt
gagtggaatgttgaccacttcttgaaagtccagcatgagcgaaggcaggaactttataag
gactattctcatcagtttttgactttggttatgatgtggaatatagatgtagaccaaatc
aagaaacaggctggaaaactctctgatatacttgatgagcaacagaagctttttcaacaa
tttcaaagtattcatatgcagaaaatagaagaatttaaggagttatgtgatcgacacttg
aagaatctacaggctattaagtgttgtcgccgaaaagctattattgaggaagccagaaaa
ctaatggactacttggaaaagagagtcactgaagaaactgttcacgtaaacaagcaggaa
gcaaaggatggtgttcaatcatcacttctatccctgctattctcgtaa

DBGET integrated database retrieval system