KEGG   Mus musculus (house mouse): 72938
Entry
72938             CDS       T01002                                 
Symbol
Ift25, 2900042B11Rik, Hspb11, PP25
Name
(RefSeq) intraflagellar transport 25
  KO
K19369  heat shock protein beta-11
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    72938 (Ift25)
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    72938 (Ift25)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP20
   72938 (Ift25)
Cilium and associated proteins [BR:mmu03037]
 Primary cilia and associated proteins
  Intraflagellar transport (IFT) complex B1
   72938 (Ift25)
SSDB
Motif
Pfam: F5_F8_type_C XRCC1_N ANAPC10
Other DBs
NCBI-GeneID: 72938
NCBI-ProteinID: NP_082670
MGI: 1920188
Ensembl: ENSMUSG00000063172
UniProt: Q9D6H2
Position
4:107110889..107137135
AA seq 143 aa
MRKVDLCSVTEGTEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVKIE
KLVIQSYLVRTLRIEKTTSKEPLDFEQWVEKDLVHTEGQLQNEEIVARDGYATFLRFIIV
SAFDHFASVHSISAEGLTVSSLP
NT seq 432 nt   +upstreamnt  +downstreamnt
atgaggaaagtggatctctgctcagtcactgaagggacagaagtgattctggccacatcg
agtgatgaaaagcacccacctgaaaacatcattgatgggaatccggaaaccttttggacc
accacaggcatgtttccccaggagttcattatttgttttcacaaacacgtaaagattgaa
aagcttgtgatacaaagttacttggtgcggactttgaggattgaaaagaccacatctaaa
gagccattggattttgagcagtgggttgaaaaagatttagtacacacagaggggcagctt
caaaatgaagaaattgtggcacgagatggctacgccactttcttgagattcattattgtc
tcagcatttgatcattttgcatctgtgcacagcatttctgcagagggactaacagtctca
agtcttccttag

DBGET integrated database retrieval system