KEGG   Mus musculus (house mouse): 72960
Entry
72960             CDS       T01002                                 
Symbol
Top1mt, 2900052H09Rik
Name
(RefSeq) DNA topoisomerase 1, mitochondrial
  KO
K03163  DNA topoisomerase I [EC:5.6.2.1]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    72960 (Top1mt)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.1  DNA topoisomerase
     72960 (Top1mt)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Topoisomerases
   72960 (Top1mt)
SSDB
Motif
Pfam: Topoisom_I Topoisom_I_N Topo_C_assoc
Other DBs
NCBI-GeneID: 72960
NCBI-ProteinID: NP_082680
MGI: 1920210
Ensembl: ENSMUSG00000000934
UniProt: Q8R4U6
Position
15:complement(75528878..75551184)
AA seq 593 aa
MLLLWLRALCRRFQHVPCRVPSCQVSRVAKANRAGWEETSKSSVKWRQLEHKGPYFTPAY
EPLPDGVHFLYDGKPLKLSLAAEEVATFYGKMLHLECTSKEVFRRNFFSDWRKEMTPEER
RLITHLDKCDFTEIHKHFLERAEARRTLPREQKQKLKEEAEKLQQEFGYCVLDGHREKIG
NFKTEPPGLFRGRGDHPKMGMLKRRVMPEDVVINCSRDSKIPEPPAGHQWKEVRSDNTVM
WLAAWVEHIQNSFKYVILNPSSKPKGEMDWQKYEVARRLKGVVDKIRAQYQADWKSPEMK
KRQLAVALYFIDKLALRTGNEKEEGETADTVGCCSLRVEHIRLHAPAGGQEHVVELDFLG
KDSIRYKNHVTVEKLVFQNLQHFMEDKDPRDDLFDALTTSSLNKHLQDLMEGLTAKVFRT
YNASVTLQEQLRVLTRAEDSVTCKVLAYNRANRAVAVLCNHQRAVPKTFEKSMQTLQKKI
ETKKAQVAEAQVELQKAETDLRMRGDSKPKSFLQKQRRLLKLEEQLARLCAKATDKEENK
QVALGTAKLNYLDPRISIAWCKRFGVPVEKIYNKTQRERFAWAFNQAGEDFEF
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgctgctgctgtggctcagagccctgtgccggcgtttccagcatgtcccctgccgcgtc
ccttcctgtcaggtgtcccgggtcgcgaaggcgaacagagccgggtgggaagaaacgagc
aagagcagtgtgaagtggaggcagctggagcacaagggcccgtacttcaccccagcctac
gagccccttcctgacggagtgcacttcctctacgatggcaaaccgctgaagctgagcttg
gcagcggaggaggtcgctaccttctatgggaaaatgctgcatcttgagtgtacgagcaag
gaagtctttcggaggaacttcttcagtgactggcggaaggagatgacacctgaggagagg
aggctcatcacacaccttgacaaatgtgacttcacggagatccataagcacttcctggaa
agagctgaggcccgcaggaccctgcccagggagcagaagcagaagctaaaggaagaggcc
gagaaactgcagcaggagtttggctattgcgttttagatggccacagagaaaaaataggc
aatttcaagacggaaccacccggcttgttccgtggccgaggtgaccatcccaagatgggg
atgttgaagaggagggtcatgccagaggatgtggtcattaactgcagcagggattccaag
atccctgagcccccagccggtcaccagtggaaagaggtacgctcagataacacagtcatg
tggctggctgcctgggtggagcacatccagaactccttcaagtatgtcatactgaacccc
agctccaagccgaagggggagatggattggcagaagtatgaggtagcgcgacgcttgaag
ggggttgtggacaagatccgtgcccagtatcaggctgactggaagtcaccagaaatgaag
aagagacagctggctgtcgccctttattttattgataagctggcactgcggacaggcaat
gagaaggaagagggcgagacggccgacaccgtgggctgctgctcgctccgtgtggagcac
atccgactgcacgcgcccgcaggtggccaggagcacgttgtagagctggacttcttggga
aaggattccatccgctataagaaccacgtgacggtggagaagctcgtgttccagaacctt
cagcacttcatggaagacaaggaccctagggatgacctctttgatgcactgaccacttcc
agcctgaacaagcacttgcaggacttgatggaagggctgacagccaaggtgttccggacc
tacaatgcctctgtcactctgcaggagcagctgcgggtgctgacccgtgcggaagacagc
gtaacctgcaaagtcttagcttacaaccgggcgaaccgggctgtggcagtcctctgtaac
catcagagagcagttcccaagaccttcgagaagtcgatgcagacacttcaaaaaaagatt
gagacaaagaaggcacaggtggctgaggcacaggtagagctgcagaaagcagagactgac
ctgagaatgagaggggacagcaaacccaaaagtttccttcagaagcagcgacgattgtta
aagctggaagaacagctggcccgattgtgcgcgaaggccacagacaaggaggagaataag
caggtggccctgggcaccgccaagctcaactatctggaccccaggatcagcatcgcctgg
tgtaagagatttggagtgcctgtggagaagatctacaacaagacccagagagagaggttt
gcctgggccttcaaccaggcaggtgaagactttgaattctaa

DBGET integrated database retrieval system