KEGG   Mus musculus (house mouse): 72973
Entry
72973             CDS       T01002                                 
Symbol
Fbxo47, 2900052P03Rik, Gm1562
Name
(RefSeq) F-box protein 47
  KO
K10321  F-box protein 47
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    72973 (Fbxo47)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     72973 (Fbxo47)
SSDB
Motif
Pfam: F-box F-box-like PRANC
Other DBs
NCBI-GeneID: 72973
NCBI-ProteinID: NP_001074904
MGI: 1920223
Ensembl: ENSMUSG00000070336
UniProt: A2A6H3
Position
11:complement(97741137..97775211)
AA seq 451 aa
MASRVNTSFTLIPKQKCRRSNHHSSYFCNTLDSDPQLLSTLGNFKVLPLEILHIILRYLS
VKDIGMLSMVSKTVSQHIINYISTSSGSRRLLLQNFHDLDLPGTKEETALLEHYRALGLL
FKRCTLLLPTKERLKYIHKILSEVSCFKFSGCSVPLQCLGLSCYGMFLQTLTAGWDELEC
HRVYNFLCELTNLSRKMQTVVCNKPGSARKLELRVRLFCRNVLLDHWTHRSDSAFWLTRI
LKPWPMVNQARLLYIIFGPTSPHDGQVIWQEMIEGPTDESSLKGLANAIKLLYDTGAKGW
TADDVISLVDELSVVPREWLLENNARLLILSGNNICFTFMASKAVNGRAVELARLVVFLA
LVCEKELYCMDWTVRMMQKVCKVFSTAAERKSFLQSIANAFACVTMEMLQPVMSGDRDDD
DRGFLNLFHLLHAQANFHKEVLYLTMNAISS
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggcgtctagagtaaataccagtttcactttgatacccaagcaaaaatgtagacgttct
aatcatcactccagctatttttgcaacacccttgattcagatcctcaactcttatctaca
cttggaaattttaaagtcttaccattggaaatattacacataattttaagatacttgtca
gtgaaagatattggcatgttaagtatggtgtctaaaacagtcagccagcacataattaat
tatatctcaacatcatctggaagtaggagacttttactacagaactttcatgaccttgat
ctgcctggcacaaaagaagagactgctctactggagcactacagagctctaggtctacta
tttaaaagatgcaccttgctgcttcccaccaaggaaagactgaagtacattcacaagata
ctctcagaagtatcctgctttaaattcagtggctgttcagttcctttgcagtgtttagga
ttatcatgttacggcatgtttttacagaccttaacagcaggttgggatgaacttgaatgc
catcgtgtgtataacttcttatgtgagctgactaatctctcccgaaagatgcagacagtt
gtctgcaacaaaccaggaagtgctcgaaaactagagttaagggttagactattctgtcgg
aatgtcctacttgatcactggacacatcgaagtgattctgcattttggttaactcgaatt
ttaaagccatggccaatggtgaatcaggcaagattgctatatattatctttggaccaaca
tctcctcatgatgggcaggtgatttggcaggaaatgatagaaggacctacagatgaatct
agtctgaaaggtttggctaatgccattaagttactgtatgacacaggtgccaaaggctgg
acagcagatgatgtcatcagtcttgtagatgaactatcagtggttccccgggagtggctt
ctggagaataatgcacgcctcctaatcctgagcgggaacaacatctgcttcactttcatg
gccagtaaagctgtaaatggacgagccgttgaactggcaagacttgtagtctttttggct
ttggtgtgtgagaaagagttgtactgcatggactggacagtcagaatgatgcagaaagtc
tgcaaagtcttcagcactgcagcagagaggaagagcttcctgcagagcatagcaaatgct
tttgcctgtgtcacgatggaaatgctgcagcctgttatgtcgggagatcgcgatgacgat
gacagaggcttcctgaatctgttccatcttctccatgctcaggcgaacttccataaggag
gtgctgtatctgaccatgaacgctatctcttcctaa

DBGET integrated database retrieval system