KEGG   Mus musculus (mouse): 73016
Entry
73016             CDS       T01002                                 

Symbol
Kremen2, 2900054E04Rik, Krm2
Name
(RefSeq) kringle containing transmembrane protein 2
  KO
K23091  kremen protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    73016 (Kremen2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Other domain-containing proteins
  CUB domain-containing proteins
   73016 (Kremen2)
SSDB
Motif
Pfam: Kringle WSC CUB
Other DBs
NCBI-GeneID: 73016
NCBI-ProteinID: NP_082692
MGI: 1920266
Ensembl: ENSMUSG00000040680
UniProt: Q8K1S7
Position
17:complement(23960173..23965305)
AA seq 461 aa
MGTPHLQGFLLLFPLLLRLHGASAGSLHSPGLSECFQVNGADYRGHQNYTGPRGAGRPCL
FWDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCHM
PGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLA
RGRPAPATDCDQICFGHPGQLCGGDGRLGIYEVSVGSCQGNWSAPQGVIYSPDFPDEYGP
DRNCSWVLGQLGAVLELTFRLFELADSRDRLELRDVSSGNLLRAFDGAHPPPPGPLRLRT
AALLLTFRSDARGHAQGFALTYRGLQDTVEGRASPEDSTESLAGDPDGANASCSPKPGAA
QASIGARVFSTVTAFSVLLLLLLSLLRLLRRRSCLLAPGKGSLAMGPSRGPGRSWAVWYR
RPRGVALPCPPGDSQAEGPAAGYRPLSASSQSSLRSLVSAL
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggggacaccacatctgcagggcttcctcctcctcttcccattgctgctgcggctgcac
ggggcctcagcagggagcctgcacagtccaggcttgtccgaatgcttccaggtgaacggc
gctgactaccgaggccaccagaactacaccggcccacgcggagctggacgcccttgtctt
ttctgggaccagacacagcagcacagctacagcagcgccagcgaccctcagggccgctgg
gggttgggtgcgcataacttctgtaggaacccagacggtgatgtgcagccctggtgctac
gtggcagagacagaagagggcatctactggcgctactgtgatatccccacatgtcacatg
cctgggtacctgggctgcttcgtggactctggggcaccccctgctctcagtggtcccagt
ggcacctccacaaagctcactgtccaagtgtgccttcgattctgccgcatgaagggctac
cagctggctggtgtggaggctggttatgcctgcttctgtggctctgaaagtgacctggcc
cgcggacgtccagcccctgccaccgactgtgaccagatctgttttggccacccaggccag
ctctgtggaggcgatggacgactaggcatctatgaagtgtctgtgggctcctgccaggga
aactggtcggctcctcaaggagtcatctactccccggattttccggatgagtatggacca
gaccggaactgcagctgggtattgggccaactgggcgctgtgctagaactcaccttccgc
ctcttcgagttggctgattctcgagaccggctggagctacgcgacgtctcgtccggcaac
ctactccgtgccttcgacggcgcccatccgccgcctccgggaccgctgcgcctgcgcact
gctgcgctgctgctcaccttccgcagcgacgcaagaggccatgctcaaggcttcgcgctc
acctaccgcgggctgcaggatacagtggagggcagagcatctccagaggattcaactgag
agtctcgcaggggaccccgatggggctaacgcgagctgcagccccaagcccggagctgca
caggcttcgataggtgcccgagtcttctccaccgtgacggccttctctgtgctgctgctg
ttgctcctgtccctactgcgtttgctgcgtcgacggagctgtctgctggctccaggaaaa
gggtctctggccatgggaccttcccggggccccgggagaagctgggctgtgtggtaccgc
cggccccgaggggtggccctgccctgtcccccaggggactctcaggctgagggtcctgct
gcgggctaccgtcccctgagtgcctccagccagagctccttgcgctcgctcgtctctgct
ctctga

DBGET integrated database retrieval system