KEGG   Mus musculus (mouse): 73090
Entry
73090             CDS       T01002                                 

Symbol
2900092C05Rik
Name
(RefSeq) RIKEN cDNA 2900092C05 gene
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF5534
Other DBs
NCBI-GeneID: 73090
NCBI-ProteinID: NP_082710
MGI: 1920340
Ensembl: ENSMUSG00000030385
Vega: OTTMUSG00000027124
UniProt: Q5I0V9
Position
7; 7 A1
AA seq 184 aa
MHKVWSSSMFLFWFLLGCLLHVCLPYADELYTVEKTTDLSGSRQLETSKSSMGQPRGLLA
ILRPTEVIIPAPRPTVKPSEFDTNKVIPRRPGLVHVISVSSIAFVIALLCGLMLSYVIYR
LVKVEEKQQLAMLYENIEIPLVDEKEASEDDGYDESQLHPENEELGKFISSVIKTKRMEN
LRRK
NT seq 555 nt   +upstreamnt  +downstreamnt
atgcacaaggtttggagttcttctatgtttttattttggtttttattgggatgcctactt
catgtctgcttgccttatgcagatgagctttatactgttgagaaaacaacagacttatca
gggagtagacagttagaaacttctaaatcttctatgggacagcccagaggcttacttgca
atacttcgaccaacagaagtaataatcccagcacctagaccaactgtgaagccatcagaa
ttcgatacaaataaagtaattccacgtaggcctggacttgttcatgtaatttcagtttca
agtatagcctttgtcattgccctgctatgtgggctcatgctctcctacgtgatatatcga
ctggtaaaagttgaggaaaaacagcagcttgcaatgttgtatgaaaatatcgagattcca
cttgtagatgagaaagaggcctctgaagatgatggttatgatgaatctcagttgcatcca
gagaatgaggagctgggaaaattcattagctcagttattaaaacaaaaagaatggaaaac
ttaagaagaaaatga

DBGET integrated database retrieval system