KEGG   Mus musculus (mouse): 73102
Entry
73102             CDS       T01002                                 

Symbol
Slc22a23, 3110004L20Rik
Name
(RefSeq) solute carrier family 22, member 23
  KO
K08215  MFS transporter, OCT family, solute carrier family 22 (organic anion transporter), member 23
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    73102 (Slc22a23)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   73102 (Slc22a23)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    73102 (Slc22a23)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 73102
NCBI-ProteinID: NP_001028339
MGI: 1920352
Ensembl: ENSMUSG00000038267
Vega: OTTMUSG00000033842
UniProt: Q3UHH2
Position
13; 13 A3.3
AA seq 689 aa
MAIDRRREAAGSGAGRQPAPAEENGSLPPGDAAASAPLGGRAGSGSSAEIQPLPALHPSG
GPHSSCCAATAAPSLLLLDYDGSVLPFLGGLGGGYQKTLVVLTWIPALFIGFSQFSDSFL
LDQPDFWCRGAGKGTELAGATVTGRWGDMGNWTSPSATPFSTASWGTTSNRSNSSDTPPL
PSPPGKGNNDSNCDCHAWDYGIRTGLIQNVVSKWDLVCDNTWKVHIAKFSLLVGLIFGYL
ITGCIADWVGRRPVLLFSTIFILIFGLTVALSVNVTMFSTLRFFEGFCLAGIILTLYALR
IELCPPGKRFIITMVASFVAMAGQFLMPGLAALCRDWQVLQALIICPFLLMLLYWSIFPE
SLRWLMATQQFESAKKLILYLTQKNCVSPESDIKGVMPELEKELSRRPKKVCIVKVVGTR
NLWKNIVVLCVNSLTGYGIHHCFARSMMGHEVKVPLLENFYADYYTMASIALASCLAMCL
VVKFLGRRGGLLLFMILTALASLLQLGLLNLIGKYSQHPDSELQLKLAVGMSDSVKDKFS
IAFSIVGMFASHAVGSLSVFFCAEITPTVIRCGGLGLVLASAGFGMLTAPIIELHNQKGY
FLHHIIFACCTLICIICILLLPESRNQNLPENIANGEHYTRQPLLPHKKGEQPLLLTNAE
LKDYSGLHDVAAVGDGLPEGATANGMKTM
NT seq 2070 nt   +upstreamnt  +downstreamnt
atggcgatagaccggcggcgtgaggcggcgggtagtggtgccgggcggcagccggccccg
gcggaggagaacggctccctgccgcccggggacgcggcggcctcggcgcccctcggaggg
cgcgcgggctccggcagcagcgcggagatccagccactgcctgcgctgcaccccagcggc
ggcccgcactcgagctgctgcgcggcgacagccgccccgagcctcctgttgctggactac
gatggctccgtgctgcccttcctcgggggcctgggcggcggctaccagaagaccctggtg
gtgctcacctggatcccggcactgttcattggcttcagccagttctcggactccttcctt
ctggaccagcccgatttctggtgccgcggggccggcaaaggcaccgagctggcgggtgcc
actgtcaccggccgatggggtgacatgggcaattggaccagcccctcggccacccccttc
tccactgcctcctgggggaccacgagcaaccgaagcaacagcagcgacacaccacccctc
ccatcccctccaggcaaggggaacaacgactcaaattgcgactgccacgcgtgggactac
ggcatccgcactggtctcatccaaaacgtggtcagcaagtgggatcttgtgtgtgataat
acctggaaagtccatatcgctaagttctccttactggttggattaatctttggctaccta
ataactggatgcattgctgactgggttggccggcggcctgtgctgctgttttccaccatc
ttcatcctcatctttggactgactgtggcactgtcagtgaatgtgacaatgttcagcaca
ctcaggttctttgaaggattttgcctggctggaatcatcctcaccttgtatgcattacga
atagagctatgccctccaggaaaacggttcataattaccatggtggcgagcttcgtggcc
atggcgggccagttcctcatgccggggctggctgcgctgtgccgggactggcaggtgttg
caggccctcatcatctgtcccttcctgctcatgctgctctactggtcgattttccctgag
tctctccgatggctaatggctacccagcaatttgaatcagcaaagaagttgatcctgtac
cttactcagaagaactgtgtgagccctgagagtgatatcaagggagtgatgccagagctc
gagaaagagctttcacggaggcccaagaaggtgtgcatcgtgaaggtggtggggacgagg
aacctgtggaaaaacattgtggttctctgtgtgaactcgctgacagggtacgggatccac
cactgctttgcaagaagcatgatgggccatgaagtgaaggtgccgctcctggagaacttc
tacgctgactactacaccatggccagcatcgcactggcctcctgcctagccatgtgtctg
gtagtcaagttcctcgggcgcaggggagggctgctgctcttcatgatcctcactgccctg
gcctcacttctacagctcgggcttctcaacttgatcggcaaatacagccagcatccagac
tcagaattgcagctgaagttggccgtagggatgagtgacagcgtcaaggacaagttctcc
attgcgttttccatcgtgggaatgtttgcatcccatgcggtggggagcctcagtgtcttc
ttctgtgcagagatcactcccacagtgataaggtgtggtgggctcgggctggtgctggcc
agtgcaggttttggcatgctgacagcgcccattattgagctgcacaaccaaaaaggctac
ttcctgcaccatatcatcttcgcctgctgcacgctcatctgcatcatttgcatcctcctg
cttcctgagagcaggaaccagaacctgcctgagaatatcgccaacggggaacactacaca
cggcaaccgctgctgccacacaagaagggagagcagcccttgctgctcaccaacgcggag
ctcaaggactactcgggcctgcatgacgtggctgcagtgggtgacgggctgccagagggg
gccactgccaatggcatgaagactatgtag

DBGET integrated database retrieval system