KEGG   Mus musculus (mouse): 73103
Entry
73103             CDS       T01002                                 

Gene name
3110009E18Rik
Definition
(RefSeq) RIKEN cDNA 3110009E18 gene
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF2340
Other DBs
NCBI-GeneID: 73103
NCBI-ProteinID: NP_082715
MGI: 1920353
Ensembl: ENSMUSG00000026388
Vega: OTTMUSG00000030546
UniProt: Q9CRW3
Position
1; 1 E2.3
AA seq 126 aa
MAAEEATLTVRLIRSFEHRNFKPVVYHGVNLHQTVKEFIIFLKQDVPLRTSLPPPLRNYK
YDTLKILHQAHKAKTNELVLGLEDDDTLLLKEDRTLKDSGVASETEIAFFCGEDYKRYKA
NPISSW
NT seq 381 nt   +upstreamnt  +downstreamnt
atggctgcggaggaagccaccctcacagttcgcctcatccgttcatttgagcatcggaat
ttcaaacctgtagtgtatcatggagtaaacttgcatcaaactgtaaaggaatttataata
tttctaaagcaagatgtccctttgaggaccagcctgccaccgcccctcagaaattacaaa
tacgatacactaaagattcttcatcaagctcacaaagcaaagacaaatgagcttgtgttg
ggtttggaggacgacgacacactcctgctaaaggaagacagaacactgaaggactcagga
gtagccagtgaaactgaaattgcattcttctgtggagaagattataagcgatacaaagct
aatcccatctcgtcctggtga

DBGET integrated database retrieval system